RegulonDB RegulonDB 10.9: Gene Form
   

yccX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmI yccA tusE yccX terminator terminator TSS_1304 (cluster) TSS_1304 (cluster) TSS_1303 TSS_1303 TSS_1302 TSS_1302 TSS_1301 (cluster) TSS_1301 (cluster) TSS_1300 TSS_1300 TSS_1299 TSS_1299 TSS_1298 TSS_1298 TSS_1297 TSS_1297 TSS_1296 TSS_1296 TSS_1295 (cluster) TSS_1295 (cluster) yccXp4 yccXp4 rlmIp4 rlmIp4 yccXp7 yccXp7 yccXp5 yccXp5

Gene      
Name: yccX    Texpresso search in the literature
Synonym(s): ECK0959, G6502, b0968
Genome position(nucleotides): 1030064 --> 1030342 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.33
External database links:  
ASAP:
ABE-0003276
ECHOBASE:
EB3490
ECOLIHUB:
yccX
OU-MICROARRAY:
b0968
STRING:
511145.b0968
COLOMBOS: yccX


Product      
Name: acylphosphatase
Synonym(s): YccX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.3
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
5 -> 5 C
8 -> 91 AWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHHPSGELTDFRI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0003998 - acylphosphatase activity
biological_process GO:0009408 - response to heat
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11502N
ECOCYC:
G6502-MONOMER
ECOLIWIKI:
b0968
INTERPRO:
IPR028627
INTERPRO:
IPR017968
INTERPRO:
IPR020456
INTERPRO:
IPR036046
INTERPRO:
IPR001792
MODBASE:
P0AB65
PANTHER:
PTHR47268
PDB:
2GV1
PFAM:
PF00708
PRIDE:
P0AB65
PRINTS:
PR00112
PROSITE:
PS00150
PROSITE:
PS00151
PROSITE:
PS51160
REFSEQ:
NP_415488
SMR:
P0AB65
SWISSMODEL:
P0AB65
UNIPROT:
P0AB65


Operon      
Name: yccX         
Operon arrangement:
Transcription unit        Promoter
yccX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yccXp5 1029980 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yccXp7 1029994 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rlmIp4 1030001 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yccXp4 1030061 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1295 (cluster) 1030888 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1296 1030891 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1297 1031154 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1298 1031167 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1299 1031229 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1300 1031236 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1301 (cluster) 1031262 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1302 1031273 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1303 1031275 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1304 (cluster) 1031345 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB