RegulonDB RegulonDB 10.8: Gene Form
   

etp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

etk gfcD gfcE etp etkp1 etkp1

Gene      
Name: etp    Texpresso search in the literature
Synonym(s): ECK0973, G6503, b0982, yccY
Genome position(nucleotides): 1044230 <-- 1044676 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.35
External database links:  
ASAP:
ABE-0003312
ECHOBASE:
EB3491
OU-MICROARRAY:
b0982
PortEco:
etp
STRING:
511145.b0982
COLOMBOS: etp


Product      
Name: phosphotyrosine-protein phosphatase Etp
Synonym(s): Etp, YccY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.386
Isoelectric point: 9.853
Motif(s):
 
Type Positions Sequence
9 -> 143 ILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLILAMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0004725 - protein tyrosine phosphatase activity
biological_process GO:0006470 - protein dephosphorylation
GO:0035335 - peptidyl-tyrosine dephosphorylation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Vincent C., et al., 2000
External database links:  
ECOCYC:
G6503-MONOMER
ECOLIWIKI:
b0982
INTERPRO:
IPR036196
INTERPRO:
IPR023485
INTERPRO:
IPR017867
MODBASE:
P0ACZ2
PANTHER:
PTHR11717:SF20
PDB:
2WJA
PFAM:
PF01451
PRIDE:
P0ACZ2
PRINTS:
PR00719
PRODB:
PRO_000022534
REFSEQ:
NP_415502
SMART:
SM00226
SMR:
P0ACZ2
UNIPROT:
P0ACZ2


Operon      
Name: gfcE-etp-etk         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter etkp1 1044303 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Vincent C., Duclos B., Grangeasse C., Vaganay E., Riberty M., Cozzone AJ., Doublet P., 2000, Relationship between exopolysaccharide production and protein-tyrosine phosphorylation in gram-negative bacteria., J Mol Biol 304(3):311-21

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB