RegulonDB RegulonDB 10.8: Gene Form
   

gfcE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

etk gfcD gfcE etp etkp1 etkp1

Gene      
Name: gfcE    Texpresso search in the literature
Synonym(s): ECK0974, G6504, b0983, yccZ
Genome position(nucleotides): 1044664 <-- 1045803 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.96
External database links:  
ASAP:
ABE-0003317
ECHOBASE:
EB3492
OU-MICROARRAY:
b0983
PortEco:
gfcE
STRING:
511145.b0983
COLOMBOS: gfcE


Product      
Name: putative exopolysaccharide export lipoprotein GfcE
Synonym(s): GfcE, YccZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 41.741
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
81 -> 165 ANYEYRIGIGDVLMVTVWDHPELTTPAGQYRSASDTGNWVNADGAIFYPYIGRLKVAGKTLTQVRNEITARLDSVIESPQVDVSV
173 -> 220 AYVTGEVSKSGQQPITNIPLTIMDAINAAGGLTADADWRNVVLTQNGV
1 -> 20 MKKNIFKFSVLTLAVLSLTA
21 -> 379 CTLVPGQNLSTSNKDVIELPDNQYDLDKMVNIYPVTPGLIDQLRAKPIMSQANPELEQQIANYEYRIGIGDVLMVTVWDHPELTTPAGQYRSASDTGNWVNADGAIFYPYIGRLKVAGKTLTQVRNEITARLDSVIESPQVDVSVAAFRSQKAYVTGEVSKSGQQPITNIPLTIMDAINAAGGLTADADWRNVVLTQNGVKTKVNLYALMQRGDLRQNKLLHPGDILFIPRNDDLKVFVMGEVGKQSTLKMDRSGMTLAEALGNAEGMNQDVADATGIFVIRATQNKQNGKIANIYQLNAKDASAMILGTEFQLEPYDIVYVTTAPLARWNRVISLLVPTISGVHDLTETSRWIQTWPN
256 -> 305 KVFVMGEVGKQSTLKMDRSGMTLAEALGNAEGMNQDVADATGIFVIRATQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0046930 - pore complex
molecular_function GO:0015288 - porin activity
GO:0015159 - polysaccharide transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0008643 - carbohydrate transport
GO:0015774 - polysaccharide transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6504-MONOMER
ECOLIWIKI:
b0983
INTERPRO:
IPR040716
INTERPRO:
IPR019554
INTERPRO:
IPR003715
PFAM:
PF02563
PFAM:
PF10531
PFAM:
PF18412
PRIDE:
P0A932
PROSITE:
PS51257
REFSEQ:
NP_415503
SMR:
P0A932
UNIPROT:
P0A932


Operon      
Name: gfcE-etp-etk         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter etkp1 1044303 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB