RegulonDB RegulonDB 10.8: Gene Form
   

gfcC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gfcD gfcE gfcC gfcB gfcA etp gfcDp3 gfcDp3

Gene      
Name: gfcC    Texpresso search in the literature
Synonym(s): ECK0976, G6506, b0985, ymcB
Genome position(nucleotides): 1047945 <-- 1048691 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.34
External database links:  
ASAP:
ABE-0003321
ECHOBASE:
EB3494
OU-MICROARRAY:
b0985
PortEco:
gfcC
STRING:
511145.b0985
COLOMBOS: gfcC


Product      
Name: capsule biosynthesis GfcC family protein
Synonym(s): GfcC, YmcB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.296
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence
1 -> 22 MNKLQSYFIASVLYVMTPHAFA
23 -> 248 QGTVTIYLPGEQQTLSVGPVENVVQLVTQPQLRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWQAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVSVLTQRVPD
21 -> 247 FAQGTVTIYLPGEQQTLSVGPVENVVQLVTQPQLRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWQAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVSVLTQRVP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Sathiyamoorthy K., et al., 2011
External database links:  
DIP:
DIP-12708N
ECOCYC:
G6506-MONOMER
ECOLIWIKI:
b0985
INTERPRO:
IPR010425
MINT:
MINT-1302737
PFAM:
PF06251
PRIDE:
P75883
REFSEQ:
NP_415505
SMR:
P75883
UNIPROT:
P75883


Operon      
Name: gfcBCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gfcDp3 1048118 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Sathiyamoorthy K., Mills E., Franzmann TM., Rosenshine I., Saper MA., 2011, The crystal structure of Escherichia coli group 4 capsule protein GfcC reveals a domain organization resembling that of Wza., Biochemistry 50(24):5465-76

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB