RegulonDB RegulonDB 10.8: Gene Form
   

gfcB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gfcD gfcC gfcB gfcA gfcDp3 gfcDp3

Gene      
Name: gfcB    Texpresso search in the literature
Synonym(s): ECK0977, G6507, b0986, ymcC
Genome position(nucleotides): 1048688 <-- 1049332 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.6
External database links:  
ASAP:
ABE-0003323
ECHOBASE:
EB3495
OU-MICROARRAY:
b0986
PortEco:
gfcB
STRING:
511145.b0986
COLOMBOS: gfcB


Product      
Name: lipoprotein GfcB
Synonym(s): GfcB, YmcC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.268
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
1 -> 15 MRPLILSIFALFLAG
16 -> 214 CTHSQQSMVDTFRASLFDNQDITVADQQIQALPYSTMYLRLNEGQRIFVVLGYIEQEQSKWLSQDNAMLVTHNGRLLKTVKLNNNLLEVTNSGQDPLRNALAIKDGSRWTRDILWSEDNHFRSATLSSTFSFAGLETLNIAGRNVLCNVWQEEVTSTRPEKQWQNTFWVDSATGQVRQSRQMLGAGVIPVEMTFLKPAP
25 -> 210 DTFRASLFDNQDITVADQQIQALPYSTMYLRLNEGQRIFVVLGYIEQEQSKWLSQDNAMLVTHNGRLLKTVKLNNNLLEVTNSGQDPLRNALAIKDGSRWTRDILWSEDNHFRSATLSSTFSFAGLETLNIAGRNVLCNVWQEEVTSTRPEKQWQNTFWVDSATGQVRQSRQMLGAGVIPVEMTFL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12709N
ECOCYC:
G6507-MONOMER
ECOLIWIKI:
b0986
INTERPRO:
IPR023373
INTERPRO:
IPR021308
MINT:
MINT-1301421
PDB:
2IN5
PFAM:
PF11102
PRIDE:
P75884
PROSITE:
PS51257
REFSEQ:
NP_415506
SMR:
P75884
UNIPROT:
P75884


Operon      
Name: gfcBCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gfcDp3 1048118 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB