RegulonDB RegulonDB 10.8: Gene Form
   

insB4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB4 insB4 insA4 cspH YjjQ YjjQ gfcAp gfcAp TSS_1309 (cluster) TSS_1309 (cluster) TSS_1308 TSS_1308 gfcAp1 gfcAp1

Gene      
Name: insB4    Texpresso search in the literature
Synonym(s): ECK0022, G6509, b0988
Genome position(nucleotides): 1050027 --> 1050530 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.76
External database links:  
ASAP:
ABE-0003338
ECHOBASE:
EB4719
ECOO157CYC:
Z1632
ECOO157CYC:
Z1562
ECOO157CYC:
Z5491
ECOO157CYC:
Z1123
ECOO157CYC:
Z1192
OU-MICROARRAY:
b0988
PortEco:
insB-4
STRING:
511145.b0988
COLOMBOS: insB4


Product      
Name: IS1 protein InsB
Synonym(s): InsB4
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.7
Isoelectric point: 10.672
Motif(s):
 
Type Positions Sequence
37 -> 167 VIVCAEMDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERYNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Escoubas JM., et al., 1994
External database links:  
ECOCYC:
G6509-MONOMER
ECOLIWIKI:
b0988
ECOO157CYC:
Z1632-MONOMER
ECOO157CYC:
Z1562-MONOMER
ECOO157CYC:
Z5491-MONOMER
ECOO157CYC:
Z1123-MONOMER
ECOO157CYC:
Z1192-MONOMER
INTERPRO:
IPR005063
PFAM:
PF03400
PRIDE:
P57998
PRODB:
PRO_000023017
REFSEQ:
NP_415508
UNIPROT:
P57998


Operon      
Name: insA4AB4B4         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gfcAp1 1049834 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1308 1049998 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1309 (cluster) 1050701 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Escoubas JM., Lane D., Chandler M., 1994, Is the IS1 transposase, InsAB', the only IS1-encoded protein required for efficient transposition?, J Bacteriol 176(18):5864-7

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB