RegulonDB RegulonDB 10.8: Gene Form
   

ymcE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yccM ymcE cspG ymcF gnsA Cis-reg; thermoregulator gnsAp gnsAp gnsAp2 gnsAp2 ymcEp3 ymcEp3

Gene      
Name: ymcE    Texpresso search in the literature
Synonym(s): ECK0981, G6512, b0991
Genome position(nucleotides): 1051847 --> 1052077 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.56
External database links:  
ASAP:
ABE-0003349
ECHOBASE:
EB3021
OU-MICROARRAY:
b0991
PortEco:
ymcE
STRING:
511145.b0991
COLOMBOS: ymcE


Product      
Name: protein YmcE
Synonym(s): YmcE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 8.727
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence
18 -> 38 FISALFFFNAVCIVSDNLLII
1 -> 76 MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLLRPEEVNSEY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6512-MONOMER
ECOLIWIKI:
b0991
INTERPRO:
IPR031853
PFAM:
PF15939
PRIDE:
P0AAA5
REFSEQ:
NP_415511
UNIPROT:
P0AAA5


Operon      
Name: ymcE-gnsA         
Operon arrangement:
Transcription unit        Promoter
gnsA
gnsA
 


RNA cis-regulatory element    
   
Cis-reg; thermoregulator cspA thermoregulator
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ymcEp3 1051830 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB