RegulonDB RegulonDB 10.8: Gene Form
   

yccM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torS yccM gnsA ymcE TSS_1311 TSS_1311

Gene      
Name: yccM    Texpresso search in the literature
Synonym(s): ECK0983, G6513, b0992
Genome position(nucleotides): 1052289 <-- 1053362 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.16
External database links:  
ASAP:
ABE-0003351
ECHOBASE:
EB3023
OU-MICROARRAY:
b0992
PortEco:
yccM
STRING:
511145.b0992
COLOMBOS: yccM


Product      
Name: putative 4Fe-4S membrane protein
Synonym(s): YccM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 40.097
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
97 -> 142 HAAAMLLLVAFIVISLLLKKAFCSWLCPVGTLSELIGDLGNKLFGR
159 -> 181 YLLLSFFIYIALLMPAQAIHYFM
201 -> 246 GTATLISVTVLLIASLFIRHAWCRYLCPYGALMGVVSLLSPFKIRR
269 -> 299 KLIQVRTVECTGCMTCVESCPVASTLTFSLQ
262 -> 262 P

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6513-MONOMER
ECOLIWIKI:
b0992
INTERPRO:
IPR017896
INTERPRO:
IPR017900
MODBASE:
P52636
PFAM:
PF12801
PRIDE:
P52636
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_415512
SMR:
P52636
UNIPROT:
P52636


Operon      
Name: yccM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1311 1053395 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB