RegulonDB RegulonDB 10.8: Gene Form
   

torT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torS torC torT torR TorR TorR TorR TorR terminator torCp torCp torRp torRp torTp2 torTp2 torTp1 torTp1 torTp7 torTp7 torSp5 torSp5

Gene      
Name: torT    Texpresso search in the literature
Synonym(s): ECK0985, G6515, b0994, yccH
Genome position(nucleotides): 1056261 --> 1057289 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.45
External database links:  
ASAP:
ABE-0003360
ECHOBASE:
EB2500
OU-MICROARRAY:
b0994
PortEco:
torT
STRING:
511145.b0994
COLOMBOS: torT


Product      
Name: periplasmic trimethylamine-N-oxide binding protein
Synonym(s): TorT, YccH
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 37.865
Isoelectric point: 9.385
Motif(s):
 
Type Positions Sequence
19 -> 342 ADNLLRWHDAQHFTVQASTPLKAKRAWKLCALYPSLKDSYWLSLNYGMQEAARRYGVDLKVLEAGGYSQLATQQAQIDQCKQWGAEAILLGSSTTSFPDLQKQVASLPVIELVNAIDAPQVKSRVGVPWFQMGYQPGRYLVQWAHGKPLNVLLMPGPDNAGGSKEMVEGFRAAIAGSPVRIVDIALGDNDIEIQRNLLQEMLERHPEIDVVAGTAIAAEAAMGEGRNLKTPLTVVSFYLSHQVYRGLKRGRVIMAASDQMVWQGELAVEQAIRQLQGQSVSDNVSPPILVLTPKNADREHIRRSLSPGGFRPVYFYQHTSAAKK
44 -> 337 AWKLCALYPSLKDSYWLSLNYGMQEAARRYGVDLKVLEAGGYSQLATQQAQIDQCKQWGAEAILLGSSTTSFPDLQKQVASLPVIELVNAIDAPQVKSRVGVPWFQMGYQPGRYLVQWAHGKPLNVLLMPGPDNAGGSKEMVEGFRAAIAGSPVRIVDIALGDNDIEIQRNLLQEMLERHPEIDVVAGTAIAAEAAMGEGRNLKTPLTVVSFYLSHQVYRGLKRGRVIMAASDQMVWQGELAVEQAIRQLQGQSVSDNVSPPILVLTPKNADREHIRRSLSPGGFRPVYFYQHT
1 -> 18 MRVLLFLLLSLFMLPAFS
59 -> 59 W
230 -> 230 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0009061 - anaerobic respiration
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Baraquet C., et al., 2006
[2] Jourlin C., et al., 1996
External database links:  
ECOCYC:
TORT-MONOMER
ECOLIWIKI:
b0994
INTERPRO:
IPR001761
INTERPRO:
IPR028082
INTERPRO:
IPR014301
MODBASE:
P38683
PFAM:
PF00532
PRIDE:
P38683
PRODB:
PRO_000024091
REFSEQ:
NP_415514
SMR:
P38683
UNIPROT:
P38683


Operon      
Name: torT         
Operon arrangement:
Transcription unit        Promoter
torT


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter torSp5 1056182 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter torTp7 1056207 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter torTp1 1056220 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter torTp2 1056222 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Baraquet C., Theraulaz L., Guiral M., Lafitte D., Mejean V., Jourlin-Castelli C., 2006, TorT, a member of a new periplasmic binding protein family, triggers induction of the Tor respiratory system upon TMAO electron-acceptor binding in Escherichia coli., J Biol Chem 281(50):38189-99

 [2] Jourlin C., Simon G., Pommier J., Chippaux M., Mejean V., 1996, The periplasmic TorT protein is required for trimethylamine N-oxide reductase gene induction in Escherichia coli., J Bacteriol 178(4):1219-23

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB