RegulonDB RegulonDB 10.8: Gene Form
   

rutF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rutG rutE rutF rutGp2 rutGp2

Gene      
Name: rutF    Texpresso search in the literature
Synonym(s): ECK0998, G6518, b1007, ycdH
Genome position(nucleotides): 1069860 <-- 1070354 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.99
External database links:  
ASAP:
ABE-0003403
ECHOBASE:
EB3614
OU-MICROARRAY:
b1007
PortEco:
rutF
STRING:
511145.b1007
COLOMBOS: rutF


Product      
Name: flavin reductase
Synonym(s): RutF, YcdH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.749
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
13 -> 159 MSCMGAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPAFNENRTLCVNTLSAGQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCAIEAIHRHTTPYGLVWFDRSYHAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016646 - oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
GO:0008752 - FMN reductase activity
GO:0048037 - cofactor binding
GO:0010181 - FMN binding
GO:0042602 - riboflavin reductase (NADPH) activity
biological_process GO:0006208 - pyrimidine nucleobase catabolic process
GO:0019740 - nitrogen utilization
GO:0055114 - oxidation-reduction process
GO:0006212 - uracil catabolic process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Loh KD., et al., 2006
[2] Zimmer DP., et al., 2000
External database links:  
ECOCYC:
G6518-MONOMER
ECOLIWIKI:
b1007
INTERPRO:
IPR002563
INTERPRO:
IPR019917
INTERPRO:
IPR012349
MODBASE:
P75893
PFAM:
PF01613
PRIDE:
P75893
REFSEQ:
NP_415527
SMART:
SM00903
SMR:
P75893
UNIPROT:
P75893


Operon      
Name: rutABCDEFG         
Operon arrangement:
Transcription unit        Promoter
rutABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP, NtrC, ArcA
Repressed by: RutR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rutGp2 1070045 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Loh KD., Gyaneshwar P., Markenscoff Papadimitriou E., Fong R., Kim KS., Parales R., Zhou Z., Inwood W., Kustu S., 2006, A previously undescribed pathway for pyrimidine catabolism., Proc Natl Acad Sci U S A 103(13):5114-9

 [2] Zimmer DP., Soupene E., Lee HL., Wendisch VF., Khodursky AB., Peter BJ., Bender RA., Kustu S., 2000, Nitrogen regulatory protein C-controlled genes of Escherichia coli: scavenging as a defense against nitrogen limitation., Proc Natl Acad Sci U S A 97(26):14674-9

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB