RegulonDB RegulonDB 10.8: Gene Form
   

efeO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

putP efeB efeO efeU CpxR efeOp1 efeOp1 efeOp2 efeOp2 efeUp efeUp

Gene      
Name: efeO    Texpresso search in the literature
Synonym(s): ECK1008, G6527, b1018, ycdO
Genome position(nucleotides): 1082243 --> 1083370 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.33
External database links:  
ASAP:
ABE-0003448
ECHOBASE:
EB3621
OU-MICROARRAY:
b1018
PortEco:
efeO
STRING:
511145.b1018
COLOMBOS: efeO


Product      
Name: ferrous iron transport system protein EfeO
Synonym(s): EfeO, YcdO
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 41.138
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
13 -> 115 SVAALFSSAFMANAADVPQVKVTVTDKQCEPMTITVNAGKTQFIIQNHSQKALEWEILKGVMVVEERENIAPGFSQKMTANLQPGEYDMTCGLLTNPKGKLIV
135 -> 368 AITAYKAYVMAETTQLVTDTKAFTDAIKAGDIEKAKALYAPTRQHYERIEPIAELFSDLDGSIDAREDDYEQKAADPKFTGFHRLEKALFGDNTTKGMDQYAEQLYTDVVDLQKRISELAFPPSKVVGGAAGLIEEVAASKISGEEDRYSHTDLWDFQANVEGSQKIVDLLRPQLQKANPELLAKVDANFKKVDTILAKYRTKDGFETYDKLTDADRNALKGPITALAEDLAQL
27 -> 375 ADVPQVKVTVTDKQCEPMTITVNAGKTQFIIQNHSQKALEWEILKGVMVVEERENIAPGFSQKMTANLQPGEYDMTCGLLTNPKGKLIVKGEATADAAQSDALLSLGGAITAYKAYVMAETTQLVTDTKAFTDAIKAGDIEKAKALYAPTRQHYERIEPIAELFSDLDGSIDAREDDYEQKAADPKFTGFHRLEKALFGDNTTKGMDQYAEQLYTDVVDLQKRISELAFPPSKVVGGAAGLIEEVAASKISGEEDRYSHTDLWDFQANVEGSQKIVDLLRPQLQKANPELLAKVDANFKKVDTILAKYRTKDGFETYDKLTDADRNALKGPITALAEDLAQLRGVLGLD
1 -> 26 MTINFRRNALQLSVAALFSSAFMANA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0006979 - response to oxidative stress
GO:0009636 - response to toxic substance
GO:0046677 - response to antibiotic
GO:0009411 - response to UV
Note(s): Note(s): ...[more].
Reference(s): [1] Maurer LM., et al., 2005
[2] McHugh JP., et al., 2003
External database links:  
ECOCYC:
G6527-MONOMER
ECOLIWIKI:
b1018
INTERPRO:
IPR034981
INTERPRO:
IPR038352
INTERPRO:
IPR028096
INTERPRO:
IPR018976
INTERPRO:
IPR008972
PFAM:
PF13473
PFAM:
PF09375
PRIDE:
P0AB24
REFSEQ:
NP_415537
SMR:
P0AB24
UNIPROT:
P0AB24


Operon      
Name: efeOB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter efeOp2 1082154 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter efeOp1 1082243 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Maurer LM., Yohannes E., Bondurant SS., Radmacher M., Slonczewski JL., 2005, pH regulates genes for flagellar motility, catabolism, and oxidative stress in Escherichia coli K-12., J Bacteriol 187(1):304-19

 [2] McHugh JP., Rodriguez-Quinones F., Abdul-Tehrani H., Svistunenko DA., Poole RK., Cooper CE., Andrews SC., 2003, Global iron-dependent gene regulation in Escherichia coli. A new mechanism for iron homeostasis., J Biol Chem 278(32):29478-86

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB