RegulonDB RegulonDB 10.8: Gene Form
   

pgaD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pgaC phoH pgaD pgaB

Gene      
Name: pgaD    Texpresso search in the literature
Synonym(s): ECK1011, G6528, b1021, hmsS, ycdP
Genome position(nucleotides): 1086106 <-- 1086519 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.2
External database links:  
ASAP:
ABE-0003460
ECHOBASE:
EB3622
OU-MICROARRAY:
b1021
PortEco:
pgaD
STRING:
511145.b1021
COLOMBOS: pgaD


Product      
Name: poly-N-acetyl-D-glucosamine synthase subunit PgaD
Synonym(s): HmsS, PgaD, YcdP, poly-beta;-1,PGA synthase subunit PgaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.082
Isoelectric point: 9.721
Motif(s):
 
Type Positions Sequence
24 -> 44 ILWTLFALFIFLFAMDLLTGY
54 -> 74 LQFYFLLAVANAVVLIVWALY
4 -> 125 LIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0043708 - cell adhesion involved in biofilm formation
GO:0043709 - cell adhesion involved in single-species biofilm formation
External database links:  
DIP:
DIP-48114N
ECOCYC:
G6528-MONOMER
ECOLIWIKI:
b1021
INTERPRO:
IPR023829
MINT:
P69432
PFAM:
PF13994
PRIDE:
P69432
PRODB:
PRO_000023522
REFSEQ:
NP_415540
UNIPROT:
P69432


Operon      
Name: pgaABCD         
Operon arrangement:
Transcription unit        Promoter
pgaABCD


Transcriptional Regulation      
Display Regulation             
Activated by: NhaR
Repressed by: OmpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB