RegulonDB RegulonDB 10.7: Gene Form
   

pgaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pgaA pgaB pgaC pgaD

Gene      
Name: pgaC    Texpresso search in the literature
Synonym(s): ECK1012, G6529, b1022, hmsR, ycdQ
Genome position(nucleotides): 1086521 <-- 1087846 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.68
External database links:  
ASAP:
ABE-0003464
ECHOBASE:
EB3623
OU-MICROARRAY:
b1022
PORTECO:
pgaC
REGULONDB:
b1022
STRING:
511145.b1022
M3D: pgaC
COLOMBOS: pgaC
PortEco: b1022


Product      
Name: poly-N-acetyl-D-glucosamine synthase subunit PgaC
Synonym(s): HmsR, PGA synthase subunit PgaC, PgaC, YcdQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 50.766
Isoelectric point: 8.931
Motif(s):
 
Type Positions Sequence
5 -> 25 IVSFFILCLVLCIPLCVAYFH
78 -> 245 SIIIPCFNEEKNVEETIHAALAQRYENIEVIAVNDGSTDKTRAILDRMAAQIPHLRVIHLAQNQGKAIALKTGAAAAKSEYLVCIDGDALLDRDAAAYIVEPMLYNPRVGAVTGNPRIRTRSTLVGKIQVGEYSSIIGLIKRTQRIYGNVFTVSGVIAAFRRSALAEV
363 -> 383 HTAGILLCTLCLLQFIVSLMI
395 -> 415 LFWIIWFPVIFWMLSLATTLV
33 -> 53 FVFFWPFFMSIMWIVGGVYFW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0008375 - acetylglucosaminyltransferase activity
biological_process GO:0043708 - cell adhesion involved in biofilm formation
External database links:  
CAZY:
GT2
DIP:
DIP-11512N
ECOCYC:
G6529-MONOMER
ECOLIWIKI:
b1022
INTERPRO:
IPR001173
INTERPRO:
IPR029044
INTERPRO:
IPR023853
MINT:
P75905
MODBASE:
P75905
PFAM:
PF00535
PRIDE:
P75905
PRODB:
PRO_000023521
PROTEINMODELPORTAL:
P75905
REFSEQ:
NP_415541
SMR:
P75905
UNIPROT:
P75905


Operon      
Name: pgaABCD         
Operon arrangement:
Transcription unit        Promoter
pgaABCD


Transcriptional Regulation      
Display Regulation             
Activated by: NhaR
Repressed by: OmpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB