RegulonDB RegulonDB 10.7: Gene Form
   

pgaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pgaA pgaB pgaC pgaD

Gene      
Name: pgaB    Texpresso search in the literature
Synonym(s): ECK1013, G6530, b1023, hmsF, ycdR
Genome position(nucleotides): 1087839 <-- 1089857 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.43
External database links:  
ASAP:
ABE-0003467
ECHOBASE:
EB3624
OU-MICROARRAY:
b1023
PORTECO:
pgaB
REGULONDB:
b1023
STRING:
511145.b1023
M3D: pgaB
COLOMBOS: pgaB
PortEco: b1023


Product      
Name: poly-β-1,6-N-acetyl-D-glucosamine N-deacetylase and β-1,6 glycoside hydrolase
Synonym(s): HmsF, PgaB, YcdR
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 77.413
Isoelectric point: 6.109
Motif(s):
 
Type Positions Sequence
114 -> 114 D
318 -> 645 HIDLDYVYDENLQQMDRNIDVLIQRVKDMQISTVYLQAFADPDGDGLVKEVWFPNRLLPMKADIFSRVAWQLRTRSGVNIYAWMPVLSWDLDPTLTRVKYLPTGEKKAQIHPEQYHRLSPFDDRVRAQVGMLYEDLAGHAAFDGILFHDDALLSDYEDASAPAITAYQQAGFSGSLSEIRQNPEQFKQWARFKSRALTDFTLELSARVKAIRGPHIKTARNIFALPVIQPESEAWFAQNYADFLKSYDWTAIMAMPYLEGVAEKSADQWLIQLTNQIKNIPQAKDKSILELQAQNWQKNGQHQAISSQQLAHWMSLLQLNGVKNYGYY
107 -> 349 KAVVLTFDDGYQSFYTRVFPILQAFQWPAVWAPVGSWVDTPADKQVKFGDELVDREYFATWQQVREVARSRLVELASHTWNSHYGIQANATGSLLPVYVNRAYFTDHARYETAAEYRERIRLDAVKMTEYLRTKVEVNPHVFVWPYGEANGIAIEELKKLGYDMFFTLESGLANASQLDSIPRVLIANNPSLKEFAQQIITVQEKSPQRIMHIDLDYVYDENLQQMDRNIDVLIQRVKDMQIS
115 -> 115 D
102 -> 270 KPLPEKAVVLTFDDGYQSFYTRVFPILQAFQWPAVWAPVGSWVDTPADKQVKFGDELVDREYFATWQQVREVARSRLVELASHTWNSHYGIQANATGSLLPVYVNRAYFTDHARYETAAEYRERIRLDAVKMTEYLRTKVEVNPHVFVWPYGEANGIAIEELKKLGYDM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0031246 - intrinsic component of periplasmic side of cell outer membrane
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
biological_process GO:0005975 - carbohydrate metabolic process
GO:0042710 - biofilm formation
GO:0043708 - cell adhesion involved in biofilm formation
GO:0098732 - macromolecule deacylation
Note(s): Note(s): ...[more].
Reference(s): [1] Agladze K., et al., 2005
External database links:  
DIP:
DIP-11513N
ECOCYC:
G6530-MONOMER
ECOLIWIKI:
b1023
INTERPRO:
IPR032772
INTERPRO:
IPR023854
INTERPRO:
IPR011330
INTERPRO:
IPR002509
MODBASE:
P75906
PDB:
4P7R
PDB:
4P7Q
PDB:
4P7O
PDB:
4P7N
PDB:
4P7L
PDB:
4F9J
PDB:
4F9D
PDB:
3VUS
PFAM:
PF14883
PFAM:
PF01522
PRIDE:
P75906
PROSITE:
PS51677
PROSITE:
PS51257
PROTEINMODELPORTAL:
P75906
REFSEQ:
NP_415542
SMR:
P75906
UNIPROT:
P75906


Operon      
Name: pgaABCD         
Operon arrangement:
Transcription unit        Promoter
pgaABCD


Transcriptional Regulation      
Display Regulation             
Activated by: NhaR
Repressed by: OmpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Agladze K., Wang X., Romeo T., 2005, Spatial periodicity of Escherichia coli K-12 biofilm microstructure initiates during a reversible, polar attachment phase of development and requires the polysaccharide adhesin PGA., J Bacteriol 187(24):8237-46


RegulonDB