RegulonDB RegulonDB 10.7: Gene Form
   

pgaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pgaA pgaB dgcT pgaC NhaR NhaR OmpR ycdTp ycdTp TSS_1319 TSS_1319 pgaAp pgaAp

Gene      
Name: pgaA    Texpresso search in the literature
Synonym(s): ECK1014, G6531, b1024, hmsH, ycdS
Genome position(nucleotides): 1089866 <-- 1092289 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.32
External database links:  
ASAP:
ABE-0003469
ECHOBASE:
EB3625
OU-MICROARRAY:
b1024
PORTECO:
pgaA
REGULONDB:
b1024
STRING:
511145.b1024
M3D: pgaA
COLOMBOS: pgaA
PortEco: b1024


Product      
Name: partially deacetylated poly-β-1,6-N-acetyl-D-glucosamine outer membrane porin
Synonym(s): HmsH, PgaA, YcdS
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 92.207
Isoelectric point: 6.561
Motif(s):
 
Type Positions Sequence
165 -> 198 KANLLAEAYIYKLAGRHQDELRAMTESLPENAST
27 -> 807 SPAAKSAVNNAYDALIIEARKGNTQPALSWFALKSALSNNQIADWLQIALWAGQDKQVITVYNRYRHQQLPARGYAAVAVAYRNLQQWQNSLTLWQKALSLEPQNKDYQRGQILTLADAGHYDTALVKLKQLNSGAPDKANLLAEAYIYKLAGRHQDELRAMTESLPENASTQQYPTEYVQALRNNQLAAAIDDANLTPDIRADIHAELVRLSFMPTRSESERYAIADRALAQYAALEILWHDNPDRTAQYQRIQVDHLGALLTRDRYKDVISHYQRLKKTGQIIPPWGQYWVASAYLKDHQPKKAQSIMTELFYHKETIAPDLSDEELADLFYSHLESENYPGALTVTQHTINTSPPFLRLMGTPTSIPNDTWLQGHSFLSTVAKYSNDLPQAEMTARELAYNAPGNQGLRIDYASVLQARGWPRAAENELKKAEVIEPRNINLEVEQAWTALTLQEWQQAAVLTHDVVEREPQDPGVVRLKRAVDVHNLAELRIAGSTGIDAEGPDSGKHDVDLTTIVYSPPLKDNWRGFAGFGYADGQFSEGKGIVRDWLAGVEWRSRNIWLEAEYAERVFNHEHKPGARLSGWYDFNDNWRIGSQLERLSHRVPLRAMKNGVTGNSAQAYVRWYQNERRKYGVSWAFTDFSDSNQRHEVSLEGQERIWSSPYLIVDFLPSLYYEQNTEHDTPYYNPIKTFDIVPAFEASHLLWRSYENSWEQIFSAGVGASWQKHYGTDVVTQLGYGQRISWNDVIDAGATLRWEKRPYDGDREHNLYVEFDMTFRF
279 -> 311 RIQVDHLGALLTRDRYKDVISHYQRLKKTGQII
98 -> 131 ARGYAAVAVAYRNLQQWQNSLTLWQKALSLEPQN
1 -> 26 MYSSSRKRCPKTKWALKLLTAAFLAA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0045203 - integral component of cell outer membrane
molecular_function GO:1901515 - poly-beta-1,6-N-acetyl-D-glucosamine transmembrane transporter activity
GO:0015159 - polysaccharide transmembrane transporter activity
biological_process GO:0042710 - biofilm formation
GO:0015774 - polysaccharide transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Agladze K., et al., 2005
[2] Wang Y., et al., 2016
External database links:  
ECOCYC:
G6531-MONOMER
ECOLIWIKI:
b1024
INTERPRO:
IPR011990
INTERPRO:
IPR013026
INTERPRO:
IPR019734
INTERPRO:
IPR023870
PDB:
4Y25
PRIDE:
P69434
PRODB:
PRO_000023520
PROSITE:
PS50005
PROSITE:
PS50293
PROTEINMODELPORTAL:
P69434
REFSEQ:
NP_415543
SMART:
SM00028
SMR:
P69434
UNIPROT:
P69434


Operon      
Name: pgaABCD         
Operon arrangement:
Transcription unit        Promoter
pgaABCD


Transcriptional Regulation      
Display Regulation             
Activated by: NhaR
Repressed by: OmpR


Regulation by small RNA    
  Display Regulation
small RNA mcaS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1319 1092840 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Agladze K., Wang X., Romeo T., 2005, Spatial periodicity of Escherichia coli K-12 biofilm microstructure initiates during a reversible, polar attachment phase of development and requires the polysaccharide adhesin PGA., J Bacteriol 187(24):8237-46

 [2] Wang Y., Andole Pannuri A., Ni D., Zhou H., Cao X., Lu X., Romeo T., Huang Y., 2016, Structural Basis for Translocation of a Biofilm-supporting Exopolysaccharide across the Bacterial Outer Membrane., J Biol Chem 291(19):10046-57

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB