RegulonDB RegulonDB 10.8: Gene Form
   

csgF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csgG csgF csgE csgGp1 csgGp1

Gene      
Name: csgF    Texpresso search in the literature
Synonym(s): ECK1024, G6544, b1038
Genome position(nucleotides): 1101711 <-- 1102127 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.45
External database links:  
ASAP:
ABE-0003519
ECHOBASE:
EB3188
OU-MICROARRAY:
b1038
PortEco:
csgF
STRING:
511145.b1038
COLOMBOS: csgF


Product      
Name: curli assembly component
Synonym(s): CsgF
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 15.056
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
1 -> 19 MRVKHAVVLLMLISPLSWA
20 -> 138 GTMTFQFRNPNFGGNPNNGAFLLNSAQAQNSYKDPSYNDDFGIETPSALDNFTQAIQSQILGGLLSNINTGKPGRMVTNDYIVDIANRDGQLQLNVTDRKTGQTSTIQVSGLQNNSTDF
6 -> 129 AVVLLMLISPLSWAGTMTFQFRNPNFGGNPNNGAFLLNSAQAQNSYKDPSYNDDFGIETPSALDNFTQAIQSQILGGLLSNINTGKPGRMVTNDYIVDIANRDGQLQLNVTDRKTGQTSTIQVS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.13 - fimbri, pili
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0098775 - curli assembly
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Chapman MR., et al., 2002
[2] Hammar M., et al., 1995
[3] Nenninger AA., et al., 2009
[4] Robinson LS., et al., 2006
External database links:  
DISPROT:
DP01177
ECOCYC:
G6544-MONOMER
ECOLIWIKI:
b1038
INTERPRO:
IPR018893
PDB:
5M1U
PFAM:
PF10614
PRIDE:
P0AE98
REFSEQ:
NP_415556
SMR:
P0AE98
UNIPROT:
P0AE98


Operon      
Name: csgDEFG         
Operon arrangement:
Transcription unit        Promoter
csgDEFG
csgDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, OmpR, IHF, RcdA, Cra, BasR, CsgD, MlrA
Repressed by: FliZ, MqsA, H-NS, CpxR, RcsAB, RstA, BtsR


Regulation by small RNA    
  Display Regulation
small RNA omrA, omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter csgGp1 1101755 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chapman MR., Robinson LS., Pinkner JS., Roth R., Heuser J., Hammar M., Normark S., Hultgren SJ., 2002, Role of Escherichia coli curli operons in directing amyloid fiber formation., Science 295(5556):851-5

 [2] Hammar M., Arnqvist A., Bian Z., Olsen A., Normark S., 1995, Expression of two csg operons is required for production of fibronectin- and congo red-binding curli polymers in Escherichia coli K-12., Mol Microbiol 18(4):661-70

 [3] Nenninger AA., Robinson LS., Hultgren SJ., 2009, Localized and efficient curli nucleation requires the chaperone-like amyloid assembly protein CsgF., Proc Natl Acad Sci U S A 106(3):900-5

 [4] Robinson LS., Ashman EM., Hultgren SJ., Chapman MR., 2006, Secretion of curli fibre subunits is mediated by the outer membrane-localized CsgG protein., Mol Microbiol 59(3):870-81

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB