RegulonDB RegulonDB 10.9: Gene Form
   

csgE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csgD csgF csgE csgGp1 csgGp1

Gene      
Name: csgE    Texpresso search in the literature
Synonym(s): ECK1025, G6545, b1039
Genome position(nucleotides): 1102152 <-- 1102541 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.08
External database links:  
ASAP:
ABE-0003528
ECHOBASE:
EB3187
ECOLIHUB:
csgE
OU-MICROARRAY:
b1039
STRING:
511145.b1039
COLOMBOS: csgE


Product      
Name: curli assembly component CsgE
Synonym(s): CsgE
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,cytosol
Molecular weight: 14.879
Isoelectric point: 5.156
Motif(s):
 
Type Positions Sequence
27 -> 128 VPGLLTDHTVSSIGHDFYRAFSDKWESDYTGNLTINERPSARWGSWITITVNQDVIFQTFLFPLKRDFEKTVVFALIQTEEALNRRQINQALLSTGDLAHDE
52 -> 52 E
1 -> 22 MKRYLRWIVAAEFLFAAGNLHA
72 -> 72 W
23 -> 129 VEVEVPGLLTDHTVSSIGHDFYRAFSDKWESDYTGNLTINERPSARWGSWITITVNQDVIFQTFLFPLKRDFEKTVVFALIQTEEALNRRQINQALLSTGDLAHDEF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.8.A - Accessory Factors Involved in Transport
Gene Ontology Terms (GO)  
cellular_component GO:0062155 - curli secretion complex
GO:0005829 - cytosol
GO:0009279 - cell outer membrane
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0098775 - curli assembly
GO:0098777 - protein secretion by the type VIII secretion system
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Goyal P., et al., 2014
[2] Hammar M., et al., 1995
[3] Wang H., et al., 2015
External database links:  
DIP:
DIP-9329N
ECOCYC:
G6545-MONOMER
ECOLIWIKI:
b1039
INTERPRO:
IPR018900
PDB:
2NA4
PFAM:
PF10627
PRIDE:
P0AE95
REFSEQ:
NP_415557
SMR:
P0AE95
UNIPROT:
P0AE95


Operon      
Name: csgDEFG         
Operon arrangement:
Transcription unit        Promoter
csgDEFG
csgDEFG
csgDEFG
csgDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, OmpR, IHF, RcdA, Cra, BasR, BolA, CsgD, MlrA
Repressed by: FliZ, MqsA, H-NS, CpxR, RcsAB, RstA, BtsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter csgGp1 1101755 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsailaki A., Jonckheere W., Pehau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H., 2014, Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG., Nature 516(7530):250-3

 [2] Hammar M., Arnqvist A., Bian Z., Olsen A., Normark S., 1995, Expression of two csg operons is required for production of fibronectin- and congo red-binding curli polymers in Escherichia coli K-12., Mol Microbiol 18(4):661-70

 [3] Wang H., Shu Q., Rempel DL., Frieden C., Gross ML., 2015, Continuous and pulsed hydrogen-deuterium exchange and mass spectrometry characterize CsgE oligomerization., Biochemistry 54(42):6475-81

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB