RegulonDB RegulonDB 10.6.3: Gene Form
   

csgD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csgD csgB csgE Cra CpxR CsgD CsgD CsgD CsgD RcdA CpxR Cra Cra CpxR CpxR CRP CsgD IHF CpxR CpxR CpxR MlrA CsgD CpxR CpxR CpxR BasR MqsA CpxR CpxR RstA CpxR CpxR OmpR IHF CpxR CRP CpxR CpxR CsgD CsgD Cra ppGpp csgBp csgBp csgDp1 csgDp1 csgDp2 csgDp2

Gene      
Name: csgD    Texpresso search in the literature
Synonym(s): ECK1026, G6546, b1040
Genome position(nucleotides): 1102546 <-- 1103196 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.78
External database links:  
ASAP:
ABE-0003530
ECHOBASE:
EB3186
ECOCYC:
G6546
ECOLIHUB:
csgD
OU-MICROARRAY:
b1040
REGULONDB:
b1040
STRING:
511145.b1040
M3D: csgD
COLOMBOS: csgD
PortEco: b1040


Product      
Name: DNA-binding transcriptional dual regulator CsgD
Synonym(s): CsgD
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol,inner membrane
Molecular weight: 24.935
Isoelectric point: 9.633
Motif(s):
 
Type Positions Sequence
173 -> 192 NNEIARSLFISENTVKTHLY
149 -> 214 NSTESALLTHREKEILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWANDNL
155 -> 210 LLTHREKEILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAVSWA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0000986 - bacterial-type proximal promoter sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:2000144 - positive regulation of DNA-templated transcription, initiation
GO:1900190 - regulation of single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-9328N
ECOCYC:
PD01379
ECOLIWIKI:
b1040
INTERPRO:
IPR016032
INTERPRO:
IPR036388
INTERPRO:
IPR000792
MINT:
MINT-1293972
MODBASE:
P52106
PFAM:
PF00196
PRIDE:
P52106
PRINTS:
PR00038
PROSITE:
PS50043
PROSITE:
PS00622
PROTEINMODELPORTAL:
P52106
REFSEQ:
NP_415558
SMART:
SM00421
SMR:
P52106
SWISSMODEL:
P52106
UNIPROT:
P52106


Operon      
Name: csgDEFG         
Operon arrangement:
Transcription unit        Promoter
csgDEFG
csgDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, OmpR, IHF, Cra, RcdA, BasR, CsgD, MlrA
Repressed by: FliZ, MqsA, CpxR, H-NS, RstA, RcsB


Regulation by small RNA    
  Display Regulation
small RNA omrB, omrA, mcaS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB