RegulonDB RegulonDB 10.6.3: Gene Form
   

csgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csgD csgB csgA Cra CpxR CsgD CsgD CsgD CsgD RcdA CpxR Cra Cra CpxR CpxR CRP CsgD IHF CpxR CpxR CpxR MlrA CsgD CpxR CpxR CpxR BasR MqsA CpxR CpxR RstA CpxR CpxR OmpR IHF CpxR CRP CpxR CpxR CsgD CsgD Cra ppGpp anti-terminator anti-anti-terminator csgBp csgBp csgDp1 csgDp1 csgDp2 csgDp2

Gene      
Name: csgB    Texpresso search in the literature
Synonym(s): ECK1027, G6547, b1041
Genome position(nucleotides): 1103951 --> 1104406 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.89
External database links:  
ASAP:
ABE-0003534
ECHOBASE:
EB2505
ECOCYC:
G6547
ECOLIHUB:
csgB
OU-MICROARRAY:
b1041
REGULONDB:
b1041
STRING:
511145.b1041
M3D: csgB
COLOMBOS: csgB
PortEco: b1041


Product      
Name: curlin, minor subunit
Synonym(s): CsgB
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus,outer membrane
Molecular weight: 15.882
Isoelectric point: 10.043
Motif(s):
 
Type Positions Sequence
1 -> 21 MKNKLLFMMLTILGAPGIAAA
100 -> 130 NDASISQGAYGNTAMIIQKGSGNKANITQYG
75 -> 106 GSSNRAKIDQTGDYNLAYIDQAGSANDASISQ
22 -> 151 AGYDLANSEYNFAVNELSKSSFNQAAIIGQAGTNNSAQLRQGGSKLLAVVAQEGSSNRAKIDQTGDYNLAYIDQAGSANDASISQGAYGNTAMIIQKGSGNKANITQYGTQKTAIVVQRQSQMAIRVTQR
53 -> 86 GTNNSAQLRQGGSKLLAVVAQEGSSNRAKIDQTG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.11 - glycoprotein
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0009289 - pilus
molecular_function GO:0042802 - identical protein binding
biological_process GO:0007155 - cell adhesion
GO:0044010 - single-species biofilm formation
GO:1990000 - amyloid fibril formation
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IGI] Inferred from genetic interaction
[IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Hammar M., et al., 1995
[2] Hammar M., et al., 1996
[3] Hammer ND., et al., 2007
[4] Shewmaker F., et al., 2009
[5] Sugimoto S., et al., 2018
External database links:  
DIP:
DIP-46504N
ECOCYC:
G6547-MONOMER
ECOLIWIKI:
b1041
INTERPRO:
IPR009742
PFAM:
PF07012
PRIDE:
P0ABK7
PROTEINMODELPORTAL:
P0ABK7
REFSEQ:
NP_415559
UNIPROT:
P0ABK7


Operon      
Name: csgBAC         
Operon arrangement:
Transcription unit        Promoter
csgBAC
csgC


Transcriptional Regulation      
Display Regulation             
Activated by: CsgD
Repressed by: FliZ, CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hammar M., Arnqvist A., Bian Z., Olsen A., Normark S., 1995, Expression of two csg operons is required for production of fibronectin- and congo red-binding curli polymers in Escherichia coli K-12., Mol Microbiol 18(4):661-70

 [2] Hammar M., Bian Z., Normark S., 1996, Nucleator-dependent intercellular assembly of adhesive curli organelles in Escherichia coli., Proc Natl Acad Sci U S A 93(13):6562-6

 [3] Hammer ND., Schmidt JC., Chapman MR., 2007, The curli nucleator protein, CsgB, contains an amyloidogenic domain that directs CsgA polymerization., Proc Natl Acad Sci U S A 104(30):12494-9

 [4] Shewmaker F., McGlinchey RP., Thurber KR., McPhie P., Dyda F., Tycko R., Wickner RB., 2009, The Functional Curli Amyloid Is Not Based on In-register Parallel {beta}-Sheet Structure., J Biol Chem 284(37):25065-76

 [5] Sugimoto S., Arita-Morioka KI., Terao A., Yamanaka K., Ogura T., Mizunoe Y., 2018, Multitasking of Hsp70 chaperone in the biogenesis of bacterial functional amyloids., Commun Biol 1:52


RegulonDB