RegulonDB RegulonDB 10.6.3: Gene Form
   

csgC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csgA csgC ymdA terminator anti-terminator anti-anti-terminator terminator ymdBp3 ymdBp3 ymdAp9 ymdAp9 ymdAp7 ymdAp7 ymdAp5 ymdAp5 ymdAp ymdAp

Gene      
Name: csgC    Texpresso search in the literature
Synonym(s): ECK1029, G6548, b1043, ycdE
Genome position(nucleotides): 1104961 --> 1105293 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.64
External database links:  
ASAP:
ABE-0003542
ECHOBASE:
EB3190
ECOCYC:
G6548
ECOLIHUB:
csgC
OU-MICROARRAY:
b1043
REGULONDB:
b1043
STRING:
511145.b1043
M3D: csgC
COLOMBOS: csgC
PortEco: b1043


Product      
Name: inhibitor of CsgA amyloid formation
Synonym(s): CsgC, YcdE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 11.967
Isoelectric point: 7.249
Motif(s):
 
Type Positions Sequence
6 -> 103 LLAALSSQITFNTTQQGDVYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQW
9 -> 110 ALSSQITFNTTQQGDVYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS
1 -> 8 MNTLLLLA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.13 - fimbri, pili
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
Note(s): Note(s): ...[more].
Reference(s): [1] Salgado PS., et al., 2011
External database links:  
ECOCYC:
G6548-MONOMER
ECOLIWIKI:
b1043
INTERPRO:
IPR014491
PFAM:
PF10610
PRIDE:
P52107
PROTEINMODELPORTAL:
P52107
REFSEQ:
NP_415561
SMR:
P52107
UNIPROT:
P52107


Operon      
Name: csgBAC         
Operon arrangement:
Transcription unit        Promoter
csgBAC
csgC


Transcriptional Regulation      
Display Regulation             
Activated by: CsgD
Repressed by: FliZ, CpxR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ymdAp5 1105225 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymdAp7 1105330 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymdAp9 1105412 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymdBp3 1105714 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado PS., Taylor JD., Cota E., Matthews SJ., 2011, Extending the usability of the phasing power of diselenide bonds: SeCys SAD phasing of CsgC using a non-auxotrophic strain., Acta Crystallogr D Biol Crystallogr 67(Pt 1):8-13

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB