RegulonDB RegulonDB 10.8: Gene Form
   

yceO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

solA yceJ yceO yceOp7 yceOp7 yceOp8 yceOp8 yceOp1 yceOp1 yceJp yceJp yceIp5 yceIp5

Gene      
Name: yceO    Texpresso search in the literature
Synonym(s): ECK1043, G6555, b1058
Genome position(nucleotides): 1119307 <-- 1119447 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
37.59
External database links:  
ASAP:
ABE-0003588
ECHOBASE:
EB4080
OU-MICROARRAY:
b1058
PortEco:
yceO
STRING:
511145.b1058
COLOMBOS: yceO


Product      
Name: DUF2770 domain-containing protein YceO
Synonym(s): YceO, small protein involved in biofilm formation and acid stress response
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 5.897
Isoelectric point: 8.931
Motif(s):
 
Type Positions Sequence
10 -> 45 MRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFY
25 -> 46 LMLYLFLWGLLAIMDLIYVFYF

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
cellular_component GO:0005887 - integral component of plasma membrane
biological_process GO:0010447 - response to acidic pH
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Herzberg M., et al., 2006
[2] Hobbs EC., et al., 2010
External database links:  
ECOCYC:
G6555-MONOMER
ECOLIWIKI:
b1058
INTERPRO:
IPR024494
PFAM:
PF10968
PRIDE:
P64442
PRODOM:
PD049682
REFSEQ:
NP_415576
UNIPROT:
P64442


Operon      
Name: solA-yceO         
Operon arrangement:
Transcription unit        Promoter
solA-yceO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yceIp5 1118641 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yceOp1 1119511 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yceOp8 1119623 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yceOp7 1119632 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Herzberg M., Kaye IK., Peti W., Wood TK., 2006, YdgG (TqsA) controls biofilm formation in Escherichia coli K-12 through autoinducer 2 transport., J Bacteriol 188(2):587-98

 [2] Hobbs EC., Astarita JL., Storz G., 2010, Small RNAs and small proteins involved in resistance to cell envelope stress and acid shock in Escherichia coli: analysis of a bar-coded mutant collection., J Bacteriol 192(1):59-67

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB