RegulonDB RegulonDB 10.8: Gene Form
   

yceM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murJ yceM yceH TSS_1341 TSS_1341 yceMp4 yceMp4

Gene      
Name: yceM    Texpresso search in the literature
Synonym(s): ECK1053, G6560, b1068, mviM
Genome position(nucleotides): 1126806 --> 1127729 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.3
External database links:  
ASAP:
ABE-0003627
ECHOBASE:
EB3638
OU-MICROARRAY:
b1068
PortEco:
yceM
STRING:
511145.b1068
COLOMBOS: yceM


Product      
Name: putative oxidoreductase YceM
Synonym(s): MviM, YceM, putative oxidoreductase, NAD(P)-binding Rossmann-fold domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.681
Isoelectric point: 7.322
Motif(s):
 
Type Positions Sequence
4 -> 121 LRIGVVGLGGIAQKAWLPVLAAASDWTLQGAWSPTRAKALPICESWRIPYADSLSSLAASCDAVFVHSSTASHFDVVSTLLNAGVHVCVDKPLAENLRDAERLVELAARKKLTLMVGF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6560-MONOMER
ECOLIWIKI:
b1068
INTERPRO:
IPR036291
INTERPRO:
IPR000683
MODBASE:
P75931
PDB:
1TLT
PFAM:
PF01408
PRIDE:
P75931
PRODB:
PRO_000023329
REFSEQ:
NP_415586
SMR:
P75931
UNIPROT:
P75931


Operon      
Name: yceM         
Operon arrangement:
Transcription unit        Promoter
mviM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yceMp4 1126604 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1341 1127783 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB