RegulonDB RegulonDB 10.8: Gene Form
   

yceQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rne rluC yceQ Cis-reg rnep3 rnep3 rnep2 rnep2 rnep1 rnep1 TSS_1364 (cluster) TSS_1364 (cluster) rnep4 rnep4 yceQp6 yceQp6 TSS_1363 TSS_1363 TSS_1362 TSS_1362 TSS_1361 TSS_1361 TSS_1360 TSS_1360 TSS_1359 TSS_1359 TSS_1358 TSS_1358 TSS_1357 TSS_1357 TSS_1356 TSS_1356 TSS_1355 TSS_1355 TSS_1354 TSS_1354 TSS_1353 TSS_1353 TSS_1352 (cluster) TSS_1352 (cluster)

Gene      
Name: yceQ    Texpresso search in the literature
Synonym(s): ECK1070, G6563, b1085
Genome position(nucleotides): 1144502 --> 1144822 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.55
External database links:  
ASAP:
ABE-0003672
ECHOBASE:
EB4308
OU-MICROARRAY:
b1085
PortEco:
yceQ
STRING:
511145.b1085
COLOMBOS: yceQ


Product      
Name: DUF2655 domain-containing protein YceQ
Synonym(s): YceQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 12.1
Isoelectric point: 8.741
Motif(s):
 
Type Positions Sequence
1 -> 82 MSVARFSCGKTAQLSKKQTGYYSPEIFPSTGKDCNPQPANCLKDQYVLRHCCVDDRSGKMGYSVKFLVLTRMDTETASLFHC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28073N
ECOCYC:
G6563-MONOMER
ECOLIWIKI:
b1085
INTERPRO:
IPR020371
PFAM:
PF10848
PRIDE:
P62066
PRODOM:
PD078424
REFSEQ:
NP_415603
UNIPROT:
P62066


Operon      
Name: yceQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1352 (cluster) 1141491 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1353 1141695 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1354 1141698 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1355 1141705 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1356 1141797 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1357 1142026 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1358 1142028 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1359 1142031 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1360 1142313 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1361 1143233 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1362 1144355 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1363 1144358 reverse nd [RS-EPT-CBR] [1]
  promoter yceQp6 1144380 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1364 (cluster) 1144680 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB