RegulonDB RegulonDB 10.9: Gene Form
   

comR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

comR ycfJ bhsA CRP bhsAp bhsAp bhsAp9 bhsAp9 bhsAp8 bhsAp8 comRp3 comRp3 comRp comRp TSS_1442 TSS_1442

Gene      
Name: comR    Texpresso search in the literature
Synonym(s): ECK1097, G6569, b1111, ycfQ
Genome position(nucleotides): 1168200 <-- 1168832 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.18
External database links:  
ASAP:
ABE-0003754
ECHOBASE:
EB3209
ECOLIHUB:
ycfQ
OU-MICROARRAY:
b1111
STRING:
511145.b1111
COLOMBOS: comR


Product      
Name: DNA-binding transcriptional repressor ComR
Synonym(s): ComR, YcfQ
Sequence: Get amino acid sequence Fasta Format
Regulator Family: TetR/AcrR
Cellular location: cytosol
Molecular weight: 23.362
Isoelectric point: 6.985
Motif(s):
 
Type Positions Sequence
25 -> 70 LDKAMKLFWQHGYEATSLADLVEATGAKAPTLYAEFTNKEGLFRAV
18 -> 78 VFDRDAALDKAMKLFWQHGYEATSLADLVEATGAKAPTLYAEFTNKEGLFRAVLDRYIDRF
41 -> 60 SLADLVEATGAKAPTLYAEF

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0046688 - response to copper ion
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[APPHINH] Assay of protein purified to homogeneity from its native host
[IEP] Inferred from expression pattern
Reference(s): [1] Mermod M., et al., 2012
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G6569-MONOMER
ECOLIWIKI:
b1111
INTERPRO:
IPR001647
INTERPRO:
IPR036271
INTERPRO:
IPR009057
MODBASE:
P75952
PFAM:
PF00440
PRIDE:
P75952
PRINTS:
PR00455
PROSITE:
PS50977
REFSEQ:
NP_415629
SMR:
P75952
UNIPROT:
P75952


Operon      
Name: comR         
Operon arrangement:
Transcription unit        Promoter
ycfQ


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1442 1168035 forward nd [RS-EPT-CBR] [3]
  promoter comRp3 1168863 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter bhsAp8 1168981 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Mermod M., Magnani D., Solioz M., Stoyanov JV., 2012, The copper-inducible ComR (YcfQ) repressor regulates expression of ComC (YcfR), which affects copper permeability of the outer membrane of Escherichia coli., Biometals 25(1):33-43

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB