RegulonDB RegulonDB 10.8: Gene Form
   

bhsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ldtC comR bhsA CRP bhsAp bhsAp bhsAp9 bhsAp9 bhsAp8 bhsAp8 comRp3 comRp3 comRp comRp

Gene      
Name: bhsA    Texpresso search in the literature
Synonym(s): ECK1098, G6570, b1112, comC, ycfR
Genome position(nucleotides): 1169073 --> 1169330 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.29
Reference(s): [1] Zhang XS., et al., 2007
External database links:  
ASAP:
ABE-0003758
ECHOBASE:
EB3210
OU-MICROARRAY:
b1112
PortEco:
bhsA
STRING:
511145.b1112
COLOMBOS: bhsA


Product      
Name: DUF1471 domain-containing multiple stress resistance outer membrane protein BhsA
Synonym(s): BhsA, ComC, YcfR, outer membrane protein involved in copper permeability, stress resistance and biofilm formation
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 8.815
Isoelectric point: 9.136
Motif(s):
 
Type Positions Sequence
1 -> 22 MKNVKTLIAAAILSSMSFASFA
23 -> 85 AVEVQSTPEGQQKVGTISANAGTNLGSLEEQLAQKADEMGAKSFRITSVTGPNTLHGTAVIYK
34 -> 85 QKVGTISANAGTNLGSLEEQLAQKADEMGAKSFRITSVTGPNTLHGTAVIYK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
biological_process GO:0006950 - response to stress
GO:0046688 - response to copper ion
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [2] Beloin C., et al., 2004
[3] Mermod M., et al., 2012
[1] Zhang XS., et al., 2007
External database links:  
DIP:
DIP-48158N
ECOCYC:
G6570-MONOMER
ECOLIWIKI:
b1112
INTERPRO:
IPR010854
INTERPRO:
IPR036275
INTERPRO:
IPR025543
PFAM:
PF07338
PRIDE:
P0AB40
PRODB:
PRO_000022220
REFSEQ:
NP_415630
SMR:
P0AB40
UNIPROT:
P0AB40


Operon      
Name: bhsA         
Operon arrangement:
Transcription unit        Promoter
bhsA
ycfR


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP, ComR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter comRp3 1168863 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter bhsAp8 1168981 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Zhang XS., Garcia-Contreras R., Wood TK., 2007, YcfR (BhsA) influences Escherichia coli biofilm formation through stress response and surface hydrophobicity., J Bacteriol 189(8):3051-62

 [2] Beloin C., Valle J., Latour-Lambert P., Faure P., Kzreminski M., Balestrino D., Haagensen JA., Molin S., Prensier G., Arbeille B., Ghigo JM., 2004, Global impact of mature biofilm lifestyle on Escherichia coli K-12 gene expression., Mol Microbiol 51(3):659-74

 [3] Mermod M., Magnani D., Solioz M., Stoyanov JV., 2012, The copper-inducible ComR (YcfQ) repressor regulates expression of ComC (YcfR), which affects copper permeability of the outer membrane of Escherichia coli., Biometals 25(1):33-43

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB