RegulonDB RegulonDB 10.8: Gene Form
   

lolD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lolE lolC ycfT nagK lolD terminator nagKp3 nagKp3 TSS_1454 TSS_1454 TSS_1453 TSS_1453 TSS_1452 TSS_1452 TSS_1451 TSS_1451 TSS_1450 TSS_1450 lolCp5 lolCp5 lolCp6 lolCp6 TSS_1449 TSS_1449 ycfTp11 ycfTp11 ycfTp9 ycfTp9

Gene      
Name: lolD    Texpresso search in the literature
Synonym(s): ECK1103, G6574, b1117, ycfV
Genome position(nucleotides): 1176619 --> 1177320 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.13
External database links:  
ASAP:
ABE-0003774
ECHOBASE:
EB3214
OU-MICROARRAY:
b1117
PortEco:
lolD
STRING:
511145.b1117
COLOMBOS: lolD


Product      
Name: lipoprotein release complex - ATP binding subunit
Synonym(s): LolD, YcfV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 25.438
Isoelectric point: 8.273
Motif(s):
 
Type Positions Sequence
6 -> 233 LQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAE
166 -> 173 LVLADEPT
93 -> 93 Y
97 -> 97 H
96 -> 96 H

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0098797 - plasma membrane protein complex
molecular_function GO:0140306 - lipoprotein releasing activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0022857 - transmembrane transporter activity
biological_process GO:0042953 - lipoprotein transport
GO:0055085 - transmembrane transport
GO:0044873 - lipoprotein localization to membrane
GO:0044874 - lipoprotein localization to outer membrane
GO:0089705 - protein localization to outer membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10115N
ECOCYC:
YCFV-MONOMER
ECOLIWIKI:
b1117
INTERPRO:
IPR011924
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR015854
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P75957
PFAM:
PF00005
PRIDE:
P75957
PRODB:
PRO_000023106
PROSITE:
PS00211
PROSITE:
PS51244
PROSITE:
PS50893
REFSEQ:
NP_415635
SMART:
SM00382
SMR:
P75957
SWISSMODEL:
P75957
UNIPROT:
P75957


Operon      
Name: lolCDE         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycfTp9 1175325 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycfTp11 1175329 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1449 1175350 forward nd [RS-EPT-CBR] [2]
  promoter lolCp6 1175374 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter lolCp5 1175399 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1450 1176220 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1451 1177193 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1452 1177616 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1453 1178231 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1454 1178238 forward nd [RS-EPT-CBR] [2]
  promoter nagKp3 1178540 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB