RegulonDB RegulonDB 10.8: Gene Form
   

cobB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nagK cobB ycfZ ymfA TSS_1455 TSS_1455

Gene      
Name: cobB    Texpresso search in the literature
Synonym(s): ECK1106, G6577, b1120, ycfY
Genome position(nucleotides): 1179520 --> 1180359 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.79
External database links:  
ASAP:
ABE-0003781
ECHOBASE:
EB3217
OU-MICROARRAY:
b1120
PortEco:
cobB
STRING:
511145.b1120
COLOMBOS: cobB


Product      
Name: protein-lysine deacetylase/desuccinylase
Synonym(s): CobB, YcfY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.464
Isoelectric point: 8.053
Motif(s):
 
Type Positions Sequence
48 -> 67 GAGISAESGIRTFRAADGLW
129 -> 132 QNID
1 -> 274 MLSRRGHRLSRFRKNKRRLRERLRQRIFFRDKVVPEAMEKPRVLVLTGAGISAESGIRTFRAADGLWEEHRVEDVATPEGFDRDPELVQAFYNARRRQLQQPEIQPNAAHLALAKLQDALGDRFLLVTQNIDNLHERAGNTNVIHMHGELLKVRCSQSGQVLDWTGDVTPEDKCHCCQFPAPLRPHVVWFGEMPLGMDEIYMALSMADIFIAIGTSGHVYPAAGFVHEAKLHGAHTVELNLEPSQVGNEFAEKYYGPASQVVPEFVEKLLKGLK
58 -> 58 R
92 -> 92 Y

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003950 - NAD+ ADP-ribosyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0034979 - NAD-dependent protein deacetylase activity
GO:0070403 - NAD+ binding
GO:0036054 - protein-malonyllysine demalonylase activity
GO:0036055 - protein-succinyllysine desuccinylase activity
biological_process GO:0006935 - chemotaxis
GO:0006476 - protein deacetylation
GO:0051607 - defense response to virus
GO:0036047 - peptidyl-lysine demalonylation
GO:0036048 - protein desuccinylation
GO:0036049 - peptidyl-lysine desuccinylation
GO:0034983 - peptidyl-lysine deacetylation
Note(s): Note(s): ...[more].
Reference(s): [1] Frye RA. 1999
[2] de Diego Puente T., et al., 2015
External database links:  
DIP:
DIP-9301N
ECOCYC:
G6577-MONOMER
ECOLIWIKI:
b1120
INTERPRO:
IPR003000
INTERPRO:
IPR029035
INTERPRO:
IPR027546
INTERPRO:
IPR026591
INTERPRO:
IPR026590
MINT:
MINT-1290133
MODBASE:
P75960
PANTHER:
PTHR11085
PDB:
1S5P
PFAM:
PF02146
PRIDE:
P75960
PRODB:
PRO_000023401
PROSITE:
PS50305
REFSEQ:
NP_415638
SMR:
P75960
UNIPROT:
P75960


Operon      
Name: nagK-cobB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1455 1179908 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Frye RA., 1999, Characterization of five human cDNAs with homology to the yeast SIR2 gene: Sir2-like proteins (sirtuins) metabolize NAD and may have protein ADP-ribosyltransferase activity., Biochem Biophys Res Commun 260(1):273-9

 [2] de Diego Puente T., Gallego-Jara J., Castano-Cerezo S., Bernal Sanchez V., Fernandez Espin V., Garcia de la Torre J., Manjon Rubio A., Canovas Diaz M., 2015, The Protein Acetyltransferase PatZ from Escherichia coli Is Regulated by Autoacetylation-induced Oligomerization., J Biol Chem 290(38):23077-93

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB