RegulonDB RegulonDB 10.8: Gene Form
   

ycfZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

potD cobB ycfZ ymfA potC terminator TSS_1456 TSS_1456 ycfZp5 ycfZp5 ycfZp6 ycfZp6 TSS_1455 TSS_1455

Gene      
Name: ycfZ    Texpresso search in the literature
Synonym(s): ECK1107, G6578, b1121
Genome position(nucleotides): 1180479 <-- 1181267 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.59
External database links:  
ASAP:
ABE-0003784
ECHOBASE:
EB3218
OU-MICROARRAY:
b1121
PortEco:
ycfZ
STRING:
511145.b1121
COLOMBOS: ycfZ


Product      
Name: putative inner membrane protein
Synonym(s): YcfZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.865
Isoelectric point: 8.99
Motif(s):
 
Type Positions Sequence
239 -> 258 ISPLWAGLIGVCTFIAALLL
183 -> 202 TLGFIAWAATFILFSRIFYY
207 -> 229 IYALKFAVAMTIANMGYQALCLY
41 -> 152 AEEIAHKAELFRQQTGIAPFIVVLPDINNEASLRQNGKAMLAHASSSLSDVKGSVLLLFTTREPRLIMITNGQVESGLDDKHLGLLIENHTLAYLNADLWYQGINNALAVLQ
5 -> 27 IILLSLLILLPLTAASKPLIPIM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11549N
ECOCYC:
G6578-MONOMER
ECOLIWIKI:
b1121
INTERPRO:
IPR007621
PFAM:
PF04536
PRIDE:
P75961
REFSEQ:
NP_415639
SMR:
P75961
UNIPROT:
P75961


Operon      
Name: ymfA-ycfZ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1455 1179908 forward nd [RS-EPT-CBR] [1]
  promoter ycfZp6 1181346 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ycfZp5 1181380 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1456 1182741 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB