RegulonDB RegulonDB 10.8: Gene Form
   

nudJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mnmA rluE nudJ Cra TSS_1479 (cluster) TSS_1479 (cluster) nudJp6 nudJp6 TSS_1478 TSS_1478 TSS_1477 TSS_1477 TSS_1476 TSS_1476 hflDp hflDp

Gene      
Name: nudJ    Texpresso search in the literature
Synonym(s): ECK1120, G6580, b1134, ymfB
Genome position(nucleotides): 1193827 <-- 1194288 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.22
External database links:  
ASAP:
ABE-0003818
ECHOBASE:
EB3220
OU-MICROARRAY:
b1134
PortEco:
nudJ
STRING:
511145.b1134
COLOMBOS: nudJ


Product      
Name: phosphatase NudJ
Synonym(s): NudJ, YmfB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.433
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
4 -> 114 PHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQ
3 -> 131 KPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQ
36 -> 57 GHLEADETLVEAAARELWEETG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016462 - pyrophosphatase activity
GO:0017111 - nucleoside-triphosphatase activity
GO:0017110 - nucleoside-diphosphatase activity
GO:0004787 - thiamine-pyrophosphatase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Bao F., et al., 2015
[2] Hong MK., et al., 2009
[3] Kumar A., et al., 2016
[4] Wang PH., et al., 2018
External database links:  
DIP:
DIP-35908N
ECOCYC:
G6580-MONOMER
ECOLIWIKI:
b1134
INTERPRO:
IPR000086
INTERPRO:
IPR033713
INTERPRO:
IPR020476
INTERPRO:
IPR020084
INTERPRO:
IPR015797
MODBASE:
P0AEI6
PDB:
4NFW
PDB:
4NFX
PFAM:
PF00293
PRIDE:
P0AEI6
PRINTS:
PR00502
PRODB:
PRO_000023427
PROSITE:
PS51462
PROSITE:
PS00893
REFSEQ:
NP_415652
SMR:
P0AEI6
SWISSMODEL:
P0AEI6
UNIPROT:
P0AEI6


Operon      
Name: rluE-nudJ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1476 1192966 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1477 1193560 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1478 1193801 reverse nd [RS-EPT-CBR] [5]
  promoter nudJp6 1194437 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter TSS_1479 (cluster) 1194944 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bao F., Yan H., Sun H., Yang P., Liu G., Zhou X., 2015, Hydrolysis of by-product adenosine diphosphate from 3'-phosphoadenosine-5'-phosphosulfate preparation using Nudix hydrolase NudJ., Appl Microbiol Biotechnol 99(24):10771-8

 [2] Hong MK., Kim JK., Ahn YJ., Kang LW., 2009, Crystallization and preliminary diffraction studies of Nudix hydrolase YmfB from Escherichia coli K-1., Protein Pept Lett 16(1):101-4

 [3] Kumar A., Beloglazova N., Bundalovic-Torma C., Phanse S., Deineko V., Gagarinova A., Musso G., Vlasblom J., Lemak S., Hooshyar M., Minic Z., Wagih O., Mosca R., Aloy P., Golshani A., Parkinson J., Emili A., Yakunin AF., Babu M., 2016, Conditional Epistatic Interaction Maps Reveal Global Functional Rewiring of Genome Integrity Pathways in Escherichia coli., Cell Rep 14(3):648-61

 [4] Wang PH., Khusnutdinova AN., Luo F., Xiao J., Nemr K., Flick R., Brown G., Mahadevan R., Edwards EA., Yakunin AF., 2018, Biosynthesis and Activity of Prenylated FMN Cofactors., Cell Chem Biol 25(5):560-570.e6

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB