RegulonDB RegulonDB 10.7: Gene Form
   

pdeG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeG ymgC ymgF ymgFp10 ymgFp10 ymgFp11 ymgFp11 ymgFp7 ymgFp7 ymgFp1 ymgFp1 ycgGp7 ycgGp7

Gene      
Name: pdeG    Texpresso search in the literature
Synonym(s): ECK1155, G6608, b1168, ycgG
Genome position(nucleotides): 1217328 --> 1218851 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.62
External database links:  
ASAP:
ABE-0003918
ECHOBASE:
EB3647
ECOO157CYC:
Z1528
ECOO157CYC:
Z2221
OU-MICROARRAY:
b1168
PORTECO:
ycgG
REGULONDB:
b1168
STRING:
511145.b1168
M3D: pdeG
COLOMBOS: pdeG
PortEco: b1168


Product      
Name: putative c-di-GMP phosphodiesterase PdeG
Synonym(s): PdeG, YcgG
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane,cytosol
Molecular weight: 56.906
Isoelectric point: 6.985
Motif(s):
 
Type Positions Sequence
5 -> 26 LIPILVAICLFITGVAILNIQL
223 -> 239 GILIFILLIACAAAFLL
217 -> 237 LIDKGFGILIFILLIACAAAF
32 -> 217 AEYLAGARYAANNINHILEEASQATQTAVNIAGKECNLEEQYQLGTEAALKPHLRTIIILKQGIVWCTSLPGNRVLLSRIPVFPDSNLLLAPAIDTVNRLPILLYQNQFADTRILVTISDQHIRGALNVPLKGVRYVLRVADDIIGPTGDVMTLNGHYPYTEKVHSTKYHFTIIFNPPPLFSFYRL
4 -> 24 TLIPILVAICLFITGVAILNI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016787 - hydrolase activity
GO:0071111 - cyclic-guanylate-specific phosphodiesterase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Sarenko O., et al., 2017
External database links:  
DIP:
DIP-11554N
ECOCYC:
G6608-MONOMER
ECOLIWIKI:
b1168
ECOO157CYC:
Z2221-MONOMER
ECOO157CYC:
Z1528-MONOMER
INTERPRO:
IPR035919
INTERPRO:
IPR001633
INTERPRO:
IPR024744
PFAM:
PF00563
PFAM:
PF12792
PRIDE:
P75995
PROSITE:
PS50883
PROTEINMODELPORTAL:
P75995
REFSEQ:
NP_415686
SMART:
SM00052
SMR:
P75995
UNIPROT:
P75995


Operon      
Name: pdeG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycgGp7 1217307 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymgFp1 1218814 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymgFp7 1218937 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymgFp11 1218940 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ymgFp10 1218953 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Sarenko O., Klauck G., Wilke FM., Pfiffer V., Richter AM., Herbst S., Kaever V., Hengge R., 2017, More than Enzymes That Make or Break Cyclic Di-GMP-Local Signaling in the Interactome of GGDEF/EAL Domain Proteins of Escherichia coli., MBio 8(5)

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB