RegulonDB RegulonDB 10.7: Gene Form
   

ymgD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycgH ymgG ymgD ymgF terminator

Gene      
Name: ymgD    Texpresso search in the literature
Synonym(s): ECK1158, G6611, b1171
Genome position(nucleotides): 1222305 <-- 1222634 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.15
External database links:  
ASAP:
ABE-0003926
ECHOBASE:
EB4040
OU-MICROARRAY:
b1171
PORTECO:
ymgD
REGULONDB:
b1171
STRING:
511145.b1171
M3D: ymgD
COLOMBOS: ymgD
PortEco: b1171


Product      
Name: PF16456 family protein YmgD
Synonym(s): YmgD
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 11.852
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
20 -> 109 QDYNIKNGLPSETYITCAEANEMAKTDSAQVAEIVAVMGNASVASRDLKIEQSPELSAKVVEKLNQVCAKDPQMLLITAIDDTMRAIGKK
26 -> 107 NGLPSETYITCAEANEMAKTDSAQVAEIVAVMGNASVASRDLKIEQSPELSAKVVEKLNQVCAKDPQMLLITAIDDTMRAIG
1 -> 19 MKKFALLAGLFVFAPMTWA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48276N
ECOCYC:
G6611-MONOMER
ECOLIWIKI:
b1171
INTERPRO:
IPR032497
INTERPRO:
IPR038304
PDB:
2LRM
PDB:
2LRV
PFAM:
PF16456
PRIDE:
P0AB46
PROTEINMODELPORTAL:
P0AB46
REFSEQ:
NP_415689
SMR:
P0AB46
UNIPROT:
P0AB46


Operon      
Name: ymgGD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB