RegulonDB RegulonDB 10.8: Gene Form
   

ycgJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

minC pliG ycgJ terminator TSS_1508 TSS_1508 ycgJp5 ycgJp5 TSS_1507 TSS_1507 TSS_1506 TSS_1506 TSS_1505 TSS_1505 TSS_1504 TSS_1504 TSS_1503 TSS_1503

Gene      
Name: ycgJ    Texpresso search in the literature
Synonym(s): ECK1165, G6614, b1177
Genome position(nucleotides): 1226600 --> 1226968 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.28
External database links:  
ASAP:
ABE-0003946
ECHOBASE:
EB3650
OU-MICROARRAY:
b1177
PortEco:
ycgJ
STRING:
511145.b1177
COLOMBOS: ycgJ


Product      
Name: PF05666 family protein YcgJ
Synonym(s): YcgJ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.414
Isoelectric point: 5.118
Motif(s):
 
Type Positions Sequence
1 -> 22 MNMMRIFYIGLSGVGMMFSSMA
23 -> 122 SGNDAGGLQSPACGVVCDPYICVNSDGISPELTRKYLGEKAAENLQSLQGYDPSEFTFANGVFCDVKEKLCRDDRYFGVDGKRSGKINQTTTKMLFMCRE
69 -> 120 SLQGYDPSEFTFANGVFCDVKEKLCRDDRYFGVDGKRSGKINQTTTKMLFMC
21 -> 61 MASGNDAGGLQSPACGVVCDPYICVNSDGISPELTRKYLGE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6614-MONOMER
ECOLIWIKI:
b1177
INTERPRO:
IPR008617
PFAM:
PF05666
PRIDE:
P76001
REFSEQ:
NP_415695
UNIPROT:
P76001


Operon      
Name: ycgJ         
Operon arrangement:
Transcription unit        Promoter
ycgJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1503 1225451 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1504 1225647 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1505 1226139 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1506 1226141 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1507 1226164 forward nd [RS-EPT-CBR] [1]
  promoter ycgJp5 1226478 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1508 1226481 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB