RegulonDB RegulonDB 10.8: Gene Form
   

pliG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pliG ycgJ ycgL terminator ycgLp ycgLp TSS_1509 TSS_1509

Gene      
Name: pliG    Texpresso search in the literature
Synonym(s): ECK1166, G6615, b1178, ycgK
Genome position(nucleotides): 1227071 <-- 1227472 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.03
External database links:  
ASAP:
ABE-0003948
ECHOBASE:
EB3651
OU-MICROARRAY:
b1178
PortEco:
ycgK
STRING:
511145.b1178
COLOMBOS: pliG


Product      
Name: inhibitor of g-type lysozyme
Synonym(s): PliG, YcgK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,periplasmic space
Molecular weight: 14.906
Isoelectric point: 9.955
Motif(s):
 
Type Positions Sequence
1 -> 22 MKIKSIRKAVLLLALLTSTSFA
23 -> 133 AGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYLFGPGIDDSVDLSRYSPELDSHGQYSLPASGKYELRVLQTRNDARKNKTKKYNVDIQIK
48 -> 111 DYDTYTFYAKKGQKVHVSISNEGADTYLFGPGIDDSVDLSRYSPELDSHGQYSLPASGKYELRV

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0060241 - lysozyme inhibitor activity
biological_process GO:0043086 - negative regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Vanderkelen L., et al., 2011
External database links:  
ECOCYC:
G6615-MONOMER
ECOLIWIKI:
b1178
INTERPRO:
IPR007280
PDB:
4DXZ
PDB:
4DY3
PDB:
4G9S
PFAM:
PF04151
PRIDE:
P76002
REFSEQ:
NP_415696
SMR:
P76002
UNIPROT:
P76002


Operon      
Name: pliG         
Operon arrangement:
Transcription unit        Promoter
pliG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1509 1227506 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Vanderkelen L., Van Herreweghe JM., Vanoirbeek KG., Baggerman G., Myrnes B., Declerck PJ., Nilsen IW., Michiels CW., Callewaert L., 2011, Identification of a bacterial inhibitor against g-type lysozyme., Cell Mol Life Sci 68(6):1053-64

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB