RegulonDB RegulonDB 10.8: Gene Form
   

ycgL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycgM pliG ycgL terminator ycgNp1 ycgNp1 ycgLp ycgLp TSS_1509 TSS_1509

Gene      
Name: ycgL    Texpresso search in the literature
Synonym(s): ECK1167, G6616, b1179
Genome position(nucleotides): 1227681 --> 1228007 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.12
External database links:  
ASAP:
ABE-0003954
ECHOBASE:
EB3652
OU-MICROARRAY:
b1179
PortEco:
ycgL
STRING:
511145.b1179
COLOMBOS: ycgL


Product      
Name: PF05166 family protein YcgL
Synonym(s): YcgL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 12.414
Isoelectric point: 9.633
Motif(s):
 
Type Positions Sequence
14 -> 86 CVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDGRKKLVNADIEKVKQALTEQGYYLQLPP
12 -> 96 MFCVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDGRKKLVNADIEKVKQALTEQGYYLQLPPPPEDLLKQHL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Junker LM., et al., 2006
External database links:  
ECOCYC:
G6616-MONOMER
ECOLIWIKI:
b1179
INTERPRO:
IPR038068
INTERPRO:
IPR027354
PANTHER:
PTHR38109
PDB:
2H7A
PFAM:
PF05166
PRIDE:
P0AB43
PRODOM:
PD030374
PROSITE:
PS51648
REFSEQ:
NP_415697
SMR:
P0AB43
UNIPROT:
P0AB43


Operon      
Name: ycgL         
Operon arrangement:
Transcription unit        Promoter
ycgL


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1509 1227506 reverse nd [RS-EPT-CBR] [2]
  promoter ycgNp1 1228683 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Junker LM., Peters JE., Hay AG., 2006, Global analysis of candidate genes important for fitness in a competitive biofilm using DNA-array-based transposon mapping., Microbiology 152(Pt 8):2233-45

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB