RegulonDB RegulonDB 10.8: Gene Form
   

ycgM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycgM ycgN ycgL ycgNp3 ycgNp3 TSS_1511 TSS_1511 TSS_1510 TSS_1510 ycgNp5 ycgNp5 ycgNp1 ycgNp1

Gene      
Name: ycgM    Texpresso search in the literature
Synonym(s): ECK1168, G6617, b1180
Genome position(nucleotides): 1228079 --> 1228738 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.97
External database links:  
ASAP:
ABE-0003957
ECHOBASE:
EB3653
OU-MICROARRAY:
b1180
PortEco:
ycgM
STRING:
511145.b1180
COLOMBOS: ycgM


Product      
Name: putative isomerase/hydrolase
Synonym(s): YcgM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.711
Isoelectric point: 6.3
Motif(s):
 
Type Positions Sequence
18 -> 210 KVVCVGSNYAKHIKEMGSAVPEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQATEEHVRKAIAGYGVALDLTLRDVQGKMKKAGQPWEKAKAFDNSCPLSGFIPAAEFTGDPQNTTLSLSVNGEQRQQGTTADMIHKIVPLIAYMSKFFTLKAGDVVLTGTPDGVGPLQSGDELTVTFD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0018773 - acetylpyruvate hydrolase activity
GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11558N
ECOCYC:
G6617-MONOMER
ECOLIWIKI:
b1180
INTERPRO:
IPR011234
INTERPRO:
IPR036663
MODBASE:
P76004
PDB:
1NR9
PFAM:
PF01557
PRIDE:
P76004
REFSEQ:
NP_415698
SMR:
P76004
UNIPROT:
P76004


Operon      
Name: ycgM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycgNp1 1228683 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycgNp5 1228750 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1510 1228797 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1511 1228804 forward nd [RS-EPT-CBR] [2]
  promoter ycgNp3 1228808 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB