RegulonDB RegulonDB 10.8: Gene Form
   

ycgN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hlyE ycgM ycgN SlyA SlyA ycgNp3 ycgNp3 TSS_1511 TSS_1511 TSS_1510 TSS_1510 ycgNp5 ycgNp5 ycgNp1 ycgNp1

Gene      
Name: ycgN    Texpresso search in the literature
Synonym(s): ECK1169, G6618, b1181
Genome position(nucleotides): 1228815 --> 1229276 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.62
External database links:  
ASAP:
ABE-0003960
ECHOBASE:
EB3654
OU-MICROARRAY:
b1181
PortEco:
ycgN
STRING:
511145.b1181
COLOMBOS: ycgN


Product      
Name: PF03693 family protein YcgN
Synonym(s): YcgN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.91
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
29 -> 97 CDGCGQCCLHKLMDEDTDEIYFTNVACRQLNIKTCQCRNYERRFEFEPDCIKLTRENLPTFEWLPMTCA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6618-MONOMER
ECOLIWIKI:
b1181
INTERPRO:
IPR005358
INTERPRO:
IPR008228
PANTHER:
PTHR37421
PFAM:
PF03692
PRIDE:
P0A8L5
REFSEQ:
NP_415699
UNIPROT:
P0A8L5


Operon      
Name: ycgN         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycgNp1 1228683 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycgNp5 1228750 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1510 1228797 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1511 1228804 forward nd [RS-EPT-CBR] [2]
  promoter ycgNp3 1228808 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB