RegulonDB RegulonDB 10.6.3: Gene Form
   

hlyE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hlyE ycgN umuD C0299 LexA LexA Fis Fis Fis FNR CRP SlyA H-NS SlyA H-NS Fis Fis SlyA SlyA SlyA SlyA umuDp umuDp hlyEp hlyEp

Gene      
Name: hlyE    Texpresso search in the literature
Synonym(s): ECK1170, G6619, b1182, clyA, hpr, sheA, ycgD
Genome position(nucleotides): 1229483 <-- 1230394 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.12
External database links:  
ASAP:
ABE-0003962
ECHOBASE:
EB3032
ECOCYC:
G6619
ECOLIHUB:
hlyE
OU-MICROARRAY:
b1182
REGULONDB:
b1182
STRING:
511145.b1182
M3D: hlyE
COLOMBOS: hlyE
PortEco: b1182


Product      
Name: hemolysin E
Synonym(s): ClyA, HlyE, Hpr, SheA, YcgD
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,extracellular space,membrane
Molecular weight: 33.758
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
13 -> 293 VKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAAAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNEYQKRHG
165 -> 165 Y
2 -> 303 TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAAAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNEYQKRHGKKTLFEVPEV
143 -> 144 NA
293 -> 294 GK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0005576 - extracellular region
GO:0016021 - integral component of membrane
GO:0020002 - host cell plasma membrane
GO:0033644 - host cell membrane
molecular_function GO:0090729 - toxin activity
GO:0042802 - identical protein binding
biological_process GO:0001897 - cytolysis by symbiont of host cells
GO:0009405 - pathogenesis
GO:0019835 - cytolysis
GO:0044179 - hemolysis in other organism
GO:0044532 - modulation of apoptotic process in other organism
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Lai XH., et al., 2000
[2] Roderer D., et al., 2014
[3] del Castillo FJ., et al., 1997
External database links:  
DIP:
DIP-9915N
ECOCYC:
G6619-MONOMER
ECOLIWIKI:
b1182
INTERPRO:
IPR027018
MINT:
P77335
MODBASE:
P77335
PDB:
4PHQ
PDB:
4PHO
PDB:
2WCD
PDB:
1QOY
PFAM:
PF06109
PRIDE:
P77335
PRODB:
PRO_000022906
PROTEINMODELPORTAL:
P77335
REFSEQ:
NP_415700
SMR:
P77335
UNIPROT:
P77335


Operon      
Name: hlyE         
Operon arrangement:
Transcription unit        Promoter
hlyE


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA, CRP, H-NS, FNR
Repressed by: H-NS, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Lai XH., Arencibia I., Johansson A., Wai SN., Oscarsson J., Kalfas S., Sundqvist KG., Mizunoe Y., Sj?stedt A., Uhlin BE., 2000, Cytocidal and apoptotic effects of the ClyA protein from Escherichia coli on primary and cultured monocytes and macrophages., Infect Immun 68(7):4363-7

 [2] Roderer D., Benke S., Muller M., Fah-Rechsteiner H., Ban N., Schuler B., Glockshuber R., 2014, Characterization of Variants of the Pore-Forming Toxin ClyA from Escherichia coli Controlled by a Redox Switch., Biochemistry 53(40):6357-69

 [3] del Castillo FJ., Leal SC., Moreno F., del Castillo I., 1997, The Escherichia coli K-12 sheA gene encodes a 34-kDa secreted haemolysin., Mol Microbiol 25(1):107-15


RegulonDB