RegulonDB RegulonDB 10.7: Gene Form
   

cvrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cvrA dadX ldcA ymgM cvrAp6 cvrAp6 TSS_1517 TSS_1517

Gene      
Name: cvrA    Texpresso search in the literature
Synonym(s): ECK1179, G6620, b1191, ycgO
Genome position(nucleotides): 1240335 <-- 1242071 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.33
External database links:  
ASAP:
ABE-0003999
ECHOBASE:
EB3655
OU-MICROARRAY:
b1191
PORTECO:
cvrA
REGULONDB:
b1191
STRING:
511145.b1191
M3D: cvrA
COLOMBOS: cvrA
PortEco: b1191


Product      
Name: putative K+:H+ antiporter
Synonym(s): CvrA, YcgO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 62.285
Isoelectric point: 4.94
Motif(s):
 
Type Positions Sequence
237 -> 257 LTTALEGSGILAVYLCGFLLG
493 -> 571 QRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGAAPVVGDQVEFAGMIWTVAEKEDNEVLKIGVRV
363 -> 383 LFFNVAFFVVLVSLLLQGTSL
6 -> 26 IISLFILGSILVTSSILLSSF
421 -> 483 LSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPALGKLF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008324 - cation transmembrane transporter activity
GO:0015297 - antiporter activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0015079 - potassium ion transmembrane transporter activity
GO:0005451 - monovalent cation:proton antiporter activity
GO:0015299 - solute:proton antiporter activity
GO:0015386 - potassium:proton antiporter activity
biological_process GO:0006811 - ion transport
GO:0006812 - cation transport
GO:0006813 - potassium ion transport
GO:0006884 - cell volume homeostasis
GO:0055085 - transmembrane transport
GO:0071805 - potassium ion transmembrane transport
GO:1902600 - proton transmembrane transport
GO:0098656 - anion transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Sharma R., et al., 2016
[2] Verkhovskaya ML., et al., 2001
External database links:  
ECOCYC:
YCGO-MONOMER
ECOLIWIKI:
b1191
INTERPRO:
IPR036318
INTERPRO:
IPR006153
INTERPRO:
IPR016169
INTERPRO:
IPR023729
INTERPRO:
IPR030151
INTERPRO:
IPR005170
INTERPRO:
IPR036721
INTERPRO:
IPR006037
PANTHER:
PTHR32507:SF7
PFAM:
PF00999
PFAM:
PF03471
PFAM:
PF02080
PRIDE:
P76007
PRODB:
PRO_000022357
PROSITE:
PS51202
PROTEINMODELPORTAL:
P76007
REFSEQ:
NP_415709
SMART:
SM01091
SMR:
P76007
UNIPROT:
P76007


Operon      
Name: cvrA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1517 1242102 reverse nd [RS-EPT-CBR] [3]
  promoter cvrAp6 1242164 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Sharma R., Shimada T., Mishra VK., Upreti S., Sardesai AA., 2016, Growth Inhibition by External Potassium of Escherichia coli Lacking PtsN (EIIANtr) Is Caused by Potassium Limitation Mediated by YcgO., J Bacteriol 198(13):1868-82

 [2] Verkhovskaya ML., Barquera B., Wikstrom M., 2001, Deletion of one of two Escherichia coli genes encoding putative Na+/H+ exchangers (ycgO) perturbs cytoplasmic alkali cation balance at low osmolarity., Microbiology 147(Pt 11):3005-13

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB