RegulonDB RegulonDB 10.7: Gene Form
   

emtA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ldcA ycgR emtA TSS_1520 TSS_1520 ldcAp9 ldcAp9 TSS_1519 TSS_1519 emtAp4 emtAp4 TSS_1518 (cluster) TSS_1518 (cluster)

Gene      
Name: emtA    Texpresso search in the literature
Synonym(s): ECK1181, G6622, b1193, mltE, sltZ, ycgP
Genome position(nucleotides): 1243180 --> 1243791 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.96
External database links:  
ASAP:
ABE-0004006
ECHOBASE:
EB3656
OU-MICROARRAY:
b1193
PORTECO:
emtA
REGULONDB:
b1193
STRING:
511145.b1193
M3D: emtA
COLOMBOS: emtA
PortEco: b1193


Product      
Name: lytic murein transglycosylase E
Synonym(s): EmtA, MltE, SltZ, YcgP
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 22.227
Isoelectric point: 9.545
Motif(s):
 
Type Positions Sequence
73 -> 73 S
173 -> 183 ADEFLEHVARN
16 -> 203 CSSKHDYTNPPWNAKVPVQRAMQWMPISQKAGAAWGVDPQLITAIIAIESGGNPNAVSKSNAIGLMQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAAYLNILETGPLAGIEDPKVLQYALVVSYANGAGALLRTFSSDRKKAISKINDLDADEFLEHVARNHPAPQAPRYIYKLEQALDAM
54 -> 66 PQLITAIIAIESG
75 -> 75 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0016829 - lyase activity
GO:0008933 - lytic transglycosylase activity
GO:0008932 - lytic endotransglycosylase activity
GO:0016837 - carbon-oxygen lyase activity, acting on polysaccharides
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0051301 - cell division
GO:0016998 - cell wall macromolecule catabolic process
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Blackburn NT., et al., 2001
[2] Byun B., et al., 2018
[3] Korsak D., et al., 2005
External database links:  
CAZY:
GH23
ECOCYC:
G6622-MONOMER
ECOLIWIKI:
b1193
INTERPRO:
IPR023946
INTERPRO:
IPR023346
INTERPRO:
IPR008258
INTERPRO:
IPR000189
MODBASE:
P76009
PDB:
6GI4
PDB:
6GI3
PDB:
6GHZ
PDB:
6GHY
PDB:
4HJZ
PDB:
4HJY
PDB:
4HJV
PDB:
3T36
PDB:
2Y8P
PFAM:
PF01464
PRIDE:
P0C960
PROSITE:
PS00922
PROSITE:
PS51257
PROTEINMODELPORTAL:
P0C960
REFSEQ:
NP_415711
SMR:
P0C960
UNIPROT:
P0C960


Operon      
Name: emtA         
Operon arrangement:
Transcription unit        Promoter
emtA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1518 (cluster) 1243112 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter emtAp4 1243125 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_1519 1243161 reverse nd [RS-EPT-CBR] [4]
  promoter ldcAp9 1243197 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_1520 1243371 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Blackburn NT., Clarke AJ., 2001, Identification of four families of peptidoglycan lytic transglycosylases., J Mol Evol 52(1):78-84

 [2] Byun B., Mahasenan KV., Dik DA., Marous DR., Speri E., Kumarasiri M., Fisher JF., Hermoso JA., Mobashery S., 2018, Mechanism of the Escherichia coli MltE lytic transglycosylase, the cell-wall-penetrating enzyme for Type VI secretion system assembly., Sci Rep 8(1):4110

 [3] Korsak D., Liebscher S., Vollmer W., 2005, Susceptibility to antibiotics and beta-lactamase induction in murein hydrolase mutants of Escherichia coli., Antimicrob Agents Chemother 49(4):1404-9

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB