RegulonDB RegulonDB 10.8: Gene Form
   

dhaL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dhaM dhaK dhaL TSS_1532 TSS_1532 TSS_1531 TSS_1531 TSS_1530 TSS_1530 TSS_1529 TSS_1529 TSS_1528 TSS_1528 TSS_1527 TSS_1527 TSS_1526 TSS_1526 TSS_1525 TSS_1525 TSS_1524 TSS_1524 TSS_1523 TSS_1523 TSS_1522 TSS_1522 TSS_1521 TSS_1521

Gene      
Name: dhaL    Texpresso search in the literature
Synonym(s): ECK1187, G6626, b1199, dhaK2, ycgS, ysgS
Genome position(nucleotides): 1249125 <-- 1249757 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.55
Reference(s): [1] Gutknecht R., et al., 2001
[2] Paulsen IT., et al., 2000
External database links:  
ASAP:
ABE-0004026
ECHOBASE:
EB3659
OU-MICROARRAY:
b1199
PortEco:
dhaL
STRING:
511145.b1199
COLOMBOS: dhaL


Product      
Name: dihydroxyacetone kinase subunit L
Synonym(s): DhaL, YcgS, YsgS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.632
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
35 -> 41 DADHGLN
38 -> 41 HGLN
32 -> 204 EIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQML
6 -> 206 TQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLAL
79 -> 80 AS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0047324 - phosphoenolpyruvate-glycerone phosphotransferase activity
GO:0000287 - magnesium ion binding
GO:0004371 - glycerone kinase activity
GO:0043531 - ADP binding
biological_process GO:0006071 - glycerol metabolic process
GO:0016310 - phosphorylation
GO:0019563 - glycerol catabolic process
Note(s): Note(s): ...[more].
Reference(s): [3] Cheek S., et al., 2005
[4] Durnin G., et al., 2009
[5] Gonzalez R., et al., 2008
External database links:  
DIP:
DIP-11562N
ECOCYC:
MONOMER0-1261
ECOLIWIKI:
b1199
INTERPRO:
IPR004007
INTERPRO:
IPR036117
INTERPRO:
IPR012737
MODBASE:
P76014
PDB:
3PNL
PDB:
2BTD
PDB:
4LRZ
PFAM:
PF02734
PRIDE:
P76014
PRODB:
PRO_000022439
PROSITE:
PS51480
REFSEQ:
NP_415717
SMART:
SM01120
SMR:
P76014
UNIPROT:
P76014


Operon      
Name: dhaKLM         
Operon arrangement:
Transcription unit        Promoter
dhaKLM
dhaM


Transcriptional Regulation      
Display Regulation             
Activated by: DhaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1521 1249121 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1522 1249128 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1523 1249497 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1524 1249736 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1525 1249868 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1526 1249893 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1527 1249898 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1528 1250032 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1529 1250044 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1530 1250148 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1531 1250415 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1532 1250830 reverse nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gutknecht R., Beutler R., Garcia-Alles LF., Baumann U., Erni B., 2001, The dihydroxyacetone kinase of Escherichia coli utilizes a phosphoprotein instead of ATP as phosphoryl donor., EMBO J 20(10):2480-6

 [2] Paulsen IT., Reizer J., Jin RZ., Lin EC., Saier MH., 2000, Functional genomic studies of dihydroxyacetone utilization in Escherichia coli., Microbiology 146 ( Pt 10):2343-4

 [3] Cheek S., Ginalski K., Zhang H., Grishin NV., 2005, A comprehensive update of the sequence and structure classification of kinases., BMC Struct Biol 5:6

 [4] Durnin G., Clomburg J., Yeates Z., Alvarez PJ., Zygourakis K., Campbell P., Gonzalez R., 2009, Understanding and harnessing the microaerobic metabolism of glycerol in Escherichia coli., Biotechnol Bioeng 103(1):148-61

 [5] Gonzalez R., Murarka A., Dharmadi Y., Yazdani SS., 2008, A new model for the anaerobic fermentation of glycerol in enteric bacteria: trunk and auxiliary pathways in Escherichia coli., Metab Eng 10(5):234-45

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB