RegulonDB RegulonDB 10.8: Gene Form
   

dhaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycgV dhaR dhaK TSS_1533 TSS_1533 dhaRp dhaRp dhaKp dhaKp TSS_1532 TSS_1532 TSS_1531 TSS_1531 TSS_1530 TSS_1530 TSS_1529 TSS_1529 TSS_1528 TSS_1528 TSS_1527 TSS_1527 TSS_1526 TSS_1526 TSS_1525 TSS_1525

Gene      
Name: dhaR    Texpresso search in the literature
Synonym(s): ECK1189, G6628, b1201, ycgU
Genome position(nucleotides): 1251066 --> 1252985 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.46
External database links:  
ASAP:
ABE-0004033
ECHOBASE:
EB3661
OU-MICROARRAY:
b1201
PortEco:
dhaR
STRING:
511145.b1201
COLOMBOS: dhaR


Product      
Name: DNA-binding transcriptional dual regulator DhaR
Synonym(s): DhaR, YcgU
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: cytosol
Molecular weight: 70.562
Isoelectric point: 6.561
Motif(s):
 
Type Positions Sequence
331 -> 490 DPQTRRLIHFGRQAARSSFPVLLCGEEGVGKALLSQAIHNESERAAGPYIAVNCELYGDAALAEEFIGGDRTDNENGRLSRLELAHGGTLFLEKIEYLAVELQSALLQVIKQGVITRLDARRLIPIDVKVIATTTADLAMLVEQNRFSRQLYYALHAFEI
327 -> 552 MPQDDPQTRRLIHFGRQAARSSFPVLLCGEEGVGKALLSQAIHNESERAAGPYIAVNCELYGDAALAEEFIGGDRTDNENGRLSRLELAHGGTLFLEKIEYLAVELQSALLQVIKQGVITRLDARRLIPIDVKVIATTTADLAMLVEQNRFSRQLYYALHAFEITIPPLRMRRGSIPALVNNKLRSLEKRFSTRLKIDDDALARLVSCAWPGNDFELYSVIENLAL
203 -> 265 NQLNALLESMDDGVISWDEQGNLQFINAQAARVLRLDATASQGRAITELLTLPAVLQQAIKQA
52 -> 189 AMLTLGQAALEDAWEYMAPRECALFILDETACILSRNGDPQTLQQLSALGFNDGTYCAEGIIGTCALSLAAISGQAVKTMADQHFKQVLWNWAFCATPLFDSKGRLTGTIALACPVEQTTAADLPLTLAIAREVGNLL
589 -> 628 AEVEKEAIINAAQVTGGRIQEMSALLGIGRTTLWRKMKQH

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008134 - transcription factor binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006071 - glycerol metabolic process
GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Bachler C., et al., 2005
External database links:  
DIP:
DIP-9438N
ECOCYC:
G6628-MONOMER
ECOLIWIKI:
b1201
INTERPRO:
IPR009057
INTERPRO:
IPR035965
INTERPRO:
IPR029016
INTERPRO:
IPR027417
INTERPRO:
IPR025943
INTERPRO:
IPR025662
INTERPRO:
IPR013767
INTERPRO:
IPR003593
INTERPRO:
IPR002197
INTERPRO:
IPR002078
INTERPRO:
IPR000014
MODBASE:
P76016
PDB:
4LRZ
PDB:
4LRY
PDB:
4LRX
PFAM:
PF00989
PFAM:
PF02954
PFAM:
PF00158
PRIDE:
P76016
PRODB:
PRO_000022441
PROSITE:
PS00675
PROSITE:
PS00676
PROSITE:
PS50045
REFSEQ:
NP_415719
SMART:
SM00382
SMART:
SM00091
SMR:
P76016
UNIPROT:
P76016


Operon      
Name: dhaR         
Operon arrangement:
Transcription unit        Promoter
dhaR


Transcriptional Regulation      
Display Regulation             
Repressed by: DhaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1525 1249868 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1526 1249893 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1527 1249898 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1528 1250032 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1529 1250044 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1530 1250148 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1531 1250415 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1532 1250830 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1533 1252373 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bachler C., Schneider P., Bahler P., Lustig A., Erni B., 2005, Escherichia coli dihydroxyacetone kinase controls gene expression by binding to transcription factor DhaR., EMBO J 24(2):283-93

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB