RegulonDB RegulonDB 10.7: Gene Form
   

ychQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prfA prmC ychA ychQ kdsAp kdsAp TSS_1548 TSS_1548 TSS_1547 (cluster) TSS_1547 (cluster) ychQp ychQp TSS_1546 TSS_1546 TSS_1545 TSS_1545

Gene      
Name: ychQ    Texpresso search in the literature
Synonym(s): ECK1201, G6630, b1213, sirB2
Genome position(nucleotides): 1266924 --> 1267316 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.58
External database links:  
ASAP:
ABE-0004071
ECHOBASE:
EB4041
OU-MICROARRAY:
b1213
PORTECO:
ychQ
REGULONDB:
b1213
STRING:
511145.b1213
M3D: ychQ
COLOMBOS: ychQ
PortEco: b1213


Product      
Name: SirB family protein YchQ
Synonym(s): YchQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.639
Isoelectric point: 11.301
Motif(s):
 
Type Positions Sequence
10 -> 28 VHLISIALSVGLLTLRFWL
74 -> 93 WLTEKLFGVIIYIVLGFIAL
105 -> 124 IIAFPLALVVLYIIIKLATT
6 -> 127 TLLSVHLISIALSVGLLTLRFWLRYQKHPQAFARWTRIVPPVVDTLLLLSGIALMAKAHILPFSGQAQWLTEKLFGVIIYIVLGFIALDYRRMHSQQARIIAFPLALVVLYIIIKLATTKVP
40 -> 59 WTRIVPPVVDTLLLLSGIAL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6630-MONOMER
ECOLIWIKI:
b1213
INTERPRO:
IPR007360
PANTHER:
PTHR39594
PFAM:
PF04247
PRIDE:
Q46755
PRODB:
PRO_000023951
PROTEINMODELPORTAL:
Q46755
REFSEQ:
NP_415731
UNIPROT:
Q46755


Operon      
Name: ychQA-kdsA         
Operon arrangement:
Transcription unit        Promoter
ychQA-kdsA
kdsA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1545 1265281 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1546 1265487 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1547 (cluster) 1267181 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1548 1267190 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB