RegulonDB RegulonDB 10.8: Gene Form
   

yciU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clsA oppF yciU oppD TSS_1681 TSS_1681 TSS_1680 TSS_1680 TSS_1679 TSS_1679 TSS_1678 TSS_1678 TSS_1677 TSS_1677 yciUp4 yciUp4 yciUp5 yciUp5 yciUp6 yciUp6 TSS_1676 TSS_1676 TSS_1675 (cluster) TSS_1675 (cluster) TSS_1674 TSS_1674

Gene      
Name: yciU    Texpresso search in the literature
Synonym(s): ECK1242, G6633, b1248
Genome position(nucleotides): 1306821 <-- 1307150 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.27
External database links:  
ASAP:
ABE-0004184
ECHOBASE:
EB4004
OU-MICROARRAY:
b1248
PortEco:
yciU
STRING:
511145.b1248
COLOMBOS: yciU


Product      
Name: DUF440 domain-containing protein YciU
Synonym(s): YciU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.687
Isoelectric point: 3.719
Motif(s):
 
Type Positions Sequence
8 -> 109 RLTEDETLEQAYDIFLELAADNLDPADVLLFNLQFEERGGAELFDPAEDWQEHVDFDLNPDFFAEVVIGLADSEDGEINDVFARILLCREKDHKLCHIIWRE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47882N
ECOCYC:
G6633-MONOMER
ECOLIWIKI:
b1248
INTERPRO:
IPR007376
INTERPRO:
IPR036763
MODBASE:
P0A8L7
PFAM:
PF04269
PRIDE:
P0A8L7
PRODOM:
PD020447
REFSEQ:
NP_415764
SMR:
P0A8L7
SWISSMODEL:
P0A8L7
UNIPROT:
P0A8L7


Operon      
Name: clsA-yciU         
Operon arrangement:
Transcription unit        Promoter
clsA-yciU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1674 1306002 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1675 (cluster) 1307175 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1676 1307286 reverse nd [RS-EPT-CBR] [1]
  promoter yciUp6 1307349 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yciUp5 1307352 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yciUp4 1307359 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1677 1307454 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1678 1307894 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1679 1307905 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1680 1307924 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1681 1308634 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB