RegulonDB RegulonDB 10.7: Gene Form
   

lapA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lapB pgpB lapA TSS_1726 TSS_1726 TSS_1725 (cluster) TSS_1725 (cluster) lapAp2 lapAp2 lapAp1 lapAp1

Gene      
Name: lapA    Texpresso search in the literature
Synonym(s): ECK1274, G6637, b1279, yciS
Genome position(nucleotides): 1340243 --> 1340551 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.16
External database links:  
ASAP:
ABE-0004298
ECHOBASE:
EB3663
OU-MICROARRAY:
b1279
PORTECO:
yciS
REGULONDB:
b1279
STRING:
511145.b1279
M3D: lapA
COLOMBOS: lapA
PortEco: b1279


Product      
Name: lipopolysaccharide assembly protein A
Synonym(s): LapA, YciS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 11.351
Isoelectric point: 10.058
Motif(s):
 
Type Positions Sequence
3 -> 23 YLLIFLLVLAIFVISVTLGAQ
23 -> 85 QNDQQVTFNYLLAQGEYRISTLLAVLFAAGFAIGWLICGLFWLRVRVSLARAERKIKRLENQL
44 -> 64 LLAVLFAAGFAIGWLICGLFW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0008653 - lipopolysaccharide metabolic process
Note(s): Note(s): ...[more].
Evidence: [IPI] Inferred from physical interaction
Reference(s): [1] Klein G., et al., 2014
External database links:  
DIP:
DIP-47880N
ECOCYC:
G6637-MONOMER
ECOLIWIKI:
b1279
INTERPRO:
IPR010445
INTERPRO:
IPR032906
PFAM:
PF06305
PRIDE:
P0ACV4
PROTEINMODELPORTAL:
P0ACV4
REFSEQ:
NP_415795
UNIPROT:
P0ACV4


Operon      
Name: lapAB-pyrF-yciH         
Operon arrangement:
Transcription unit        Promoter
lapAB
yciSM-pyrF-yciH
lapAB
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1725 (cluster) 1340187 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1726 1340213 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Klein G., Kobylak N., Lindner B., Stupak A., Raina S., 2014, Assembly of lipopolysaccharide in Escherichia coli requires the essential LapB heat shock protein., J Biol Chem 289(21):14829-53

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB