RegulonDB RegulonDB 10.7: Gene Form
   

ycjD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sapF ycjD nc7 FadR terminator ycjDp5 ycjDp5 ycjDp4 ycjDp4 fabIp fabIp fabIp1 fabIp1

Gene      
Name: ycjD    Texpresso search in the literature
Synonym(s): ECK1284, G6641, b1289
Genome position(nucleotides): 1351407 <-- 1351760 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.72
External database links:  
ASAP:
ABE-0004333
ECHOBASE:
EB2523
OU-MICROARRAY:
b1289
PORTECO:
ycjD
REGULONDB:
b1289
STRING:
511145.b1289
M3D: ycjD
COLOMBOS: ycjD
PortEco: b1289


Product      
Name: DUF559 domain-containing protein YcjD
Synonym(s): YcjD
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.989
Isoelectric point: 9.311
Motif(s):
 
Type Positions Sequence
4 -> 111 KIKSNARDLRRNLTLQERKLWRYLRSRRFSDFKFRRQHPVGSYILDFACCSARVVVELDGGQHDLAVAYDSRRTSWLESQGWTVLRFWNNEIDCNEETVLENILQELN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6641-MONOMER
ECOLIWIKI:
b1289
INTERPRO:
IPR007569
INTERPRO:
IPR011335
PANTHER:
PTHR38590
PFAM:
PF04480
PRIDE:
P45736
PROTEINMODELPORTAL:
P45736
REFSEQ:
NP_415805
SMR:
P45736
UNIPROT:
P45736


Operon      
Name: ycjD         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycjDp4 1351866 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycjDp5 1351896 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB