RegulonDB RegulonDB 10.7: Gene Form
   

ymjA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sapA puuP ymjA ymjE sapB terminator ymjAp5 ymjAp5 TSS_1740 TSS_1740 TSS_1739 TSS_1739 TSS_1738 TSS_1738 TSS_1737 TSS_1737

Gene      
Name: ymjA    Texpresso search in the literature
Synonym(s): ECK1290, G6642, b1295
Genome position(nucleotides): 1357423 <-- 1357668 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.37
External database links:  
ASAP:
ABE-0004359
ECHOBASE:
EB4043
OU-MICROARRAY:
b1295
PORTECO:
ymjA
REGULONDB:
b1295
STRING:
511145.b1295
M3D: ymjA
COLOMBOS: ymjA
PortEco: b1295


Product      
Name: DUF2543 domain-containing protein YmjA
Synonym(s): YmjA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.321
Isoelectric point: 3.897
Motif(s):
 
Type Positions Sequence
1 -> 81 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G6642-MONOMER
ECOLIWIKI:
b1295
INTERPRO:
IPR020251
PFAM:
PF10820
PRIDE:
P0ACV8
PRODOM:
PD059807
PROTEINMODELPORTAL:
P0ACV8
REFSEQ:
NP_415811
UNIPROT:
P0ACV8


Operon      
Name: ymjA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1737 1355493 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1738 1356037 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1739 1357699 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1740 1357701 reverse nd [RS-EPT-CBR] [2]
  promoter ymjAp5 1357810 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB