RegulonDB RegulonDB 10.8: Gene Form
   

ycjQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjQ ycjP ycjR ycjO

Gene      
Name: ycjQ    Texpresso search in the literature
Synonym(s): ECK1308, G6651, b1313
Genome position(nucleotides): 1374963 --> 1376015 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.75
External database links:  
ASAP:
ABE-0004412
ECHOBASE:
EB3673
OU-MICROARRAY:
b1313
PortEco:
ycjQ
STRING:
511145.b1313
COLOMBOS: ycjQ


Product      
Name: D-guloside 3-dehydrogenase
Synonym(s): YcjQ, putative oxidoreductase, Zn-dependent and NAD(P)-binding, putative zinc-binding dehydrogenase YcjQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.216
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
168 -> 286 AIGQIAIQLAKRAGASVVIGVDPIAHRCDIARRHGADFCLNPIGTDVGKEIKTLTGKQGADVIIETSGYADALQSALRGLAYGGTISYVAFAKPFAEGFNLGREAHFNNAKIVFSRACS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008270 - zinc ion binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11608N
ECOCYC:
G6651-MONOMER
ECOLIWIKI:
b1313
INTERPRO:
IPR036291
INTERPRO:
IPR013149
INTERPRO:
IPR011032
MODBASE:
P76043
PANTHER:
PTHR11695
PFAM:
PF00107
PRIDE:
P76043
PROSITE:
PS00059
REFSEQ:
NP_415829
SMR:
P76043
UNIPROT:
P76043


Operon      
Name: ycjMNOPQRSTUV-ymjB-ompG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB