RegulonDB RegulonDB 10.8: Gene Form
   

ycjS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjT ycjS ycjR ycjU

Gene      
Name: ycjS    Texpresso search in the literature
Synonym(s): ECK1310, G6653, b1315
Genome position(nucleotides): 1376832 --> 1377887 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.73
External database links:  
ASAP:
ABE-0004416
ECHOBASE:
EB3675
OU-MICROARRAY:
b1315
PortEco:
ycjS
STRING:
511145.b1315
COLOMBOS: ycjS


Product      
Name: D-glucoside 3-dehydrogenase
Synonym(s): YcjS
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 38.652
Isoelectric point: 5.919
Motif(s):
 
Type Positions Sequence
142 -> 249 REQVTNGVLGEIYVTTARALRRCGVPGWGVFTNKELQGGGPLIDIGIHMLDAAMYVLGFPAVKSVNAHSFQKIGTQKSCGQFGEWDPATYSVEDSLFGTIEFHNGGIL
10 -> 128 LRVAIIGAGQVADKVHASYYCTRNDLELVAVCDSRLSQAQALAEKYGNASVWDDPQAMLLAVKPDVVSVCSPNRFHYEHTLMALEAGCHVMCEKPPAMTPEQAREMCDTARKLGKVLAY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
biological_process GO:0005975 - carbohydrate metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6653-MONOMER
ECOLIWIKI:
b1315
INTERPRO:
IPR000683
INTERPRO:
IPR036291
INTERPRO:
IPR004104
MODBASE:
P77503
PFAM:
PF01408
PFAM:
PF02894
PRIDE:
P77503
REFSEQ:
NP_415831
SMR:
P77503
UNIPROT:
P77503


Operon      
Name: ycjMNOPQRSTUV-ymjB-ompG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB