RegulonDB RegulonDB 10.6.3: Gene Form
   

ycjX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tyrR ycjX ycjF ycjW TyrR TyrR TSS_1747 TSS_1747 tyrRp tyrRp TSS_1746 TSS_1746 ycjXp ycjXp ycjWp2 ycjWp2 TSS_1745 TSS_1745

Gene      
Name: ycjX    Texpresso search in the literature
Synonym(s): ECK1317, G6659, b1321
Genome position(nucleotides): 1384117 --> 1385514 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.43
External database links:  
ASAP:
ABE-0004433
ECHOBASE:
EB3680
ECOCYC:
G6659
ECOLIHUB:
ycjX
OU-MICROARRAY:
b1321
REGULONDB:
b1321
STRING:
511145.b1321
M3D: ycjX
COLOMBOS: ycjX
PortEco: b1321


Product      
Name: DUF463 domain-containing protein YcjX
Synonym(s): YcjX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.61
Isoelectric point: 8.317
Motif(s):
 
Type Positions Sequence
26 -> 33 GLSRSGKT
20 -> 464 LRLAVTGLSRSGKTAFITAMVNQLLNIHAGARLPLLSAVREERLLGVKRIPQRDFGIPRFTYDEGLAQLYGDPPAWPTPTRGVSEIRLALRFKSNDSLLRHFKDTSTLYLEIVDYPGEWLLDLPMLAQDYLSWSRQMTGLLNGQRGEWSAKWRMMSEGLDPLAPADENRLADIAAAWTDYLHHCKEQGLHFIQPGRFVLPGDMAGAPALQFFPWPDVDTWGESKLAQADKHTNAGMLRERFNYYCEKVVKGFYKNHFLRFDRQIVLVDCLQPLNSGPQAFNDMRLALTQLMQSFHYGQRTLFRRLFSPVIDKLLFAATKADHVTIDQHANMVSLLQQLIQDAWQNAAFEGISMDCLGLASVQATTSGIIDVNGEKIPALRGNRLSDGAPLTVYPGEVPARLPGQAFWDKQGFQFEAFRPQVMDVDKPLPHIRLDAALEFLIGDKL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11615N
ECOCYC:
G6659-MONOMER
ECOLIWIKI:
b1321
INTERPRO:
IPR007413
PANTHER:
PTHR38605
PFAM:
PF04317
PRIDE:
P76046
PROTEINMODELPORTAL:
P76046
REFSEQ:
NP_415837
SMR:
P76046
UNIPROT:
P76046


Operon      
Name: ycjXF-tyrR         
Operon arrangement:
Transcription unit        Promoter
ycjXF-tyrR
tyrR
null


Transcriptional Regulation      
Display Regulation             
Repressed by: PgrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1745 1383989 reverse nd [RS-EPT-CBR] [1]
  promoter ycjWp2 1383991 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1746 1386691 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1747 1387697 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB