RegulonDB RegulonDB 10.7: Gene Form
   

ycjG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ycjG    Texpresso search in the literature
Synonym(s): ECK1321, G6661, b1325, ycjH
Genome position(nucleotides): 1388930 --> 1389895 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.66
Reference(s): [1] Schmidt DM., et al., 2001
External database links:  
ASAP:
ABE-0004448
ECHOBASE:
EB3018
OU-MICROARRAY:
b1325
PORTECO:
ycjG
REGULONDB:
b1325
STRING:
511145.b1325
M3D: ycjG
COLOMBOS: ycjG
PortEco: b1325


Product      
Name: L-Ala-D/L-Glu epimerase
Synonym(s): YcjG, YcjH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.674
Isoelectric point: 4.698
Motif(s):
 
Type Positions Sequence
236 -> 236 A
259 -> 259 A
301 -> 301 P
1 -> 112 MRTVKVFEEAWPLHTPFVIARGSRSEARVVVVELEEEGIKGTGECTPYPRYGESDASVMAQIMSVVPQLEKGLTREELQKILPAGAARNALDCALWDLAARRQQQSLADLIG
244 -> 244 V

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016855 - racemase and epimerase activity, acting on amino acids and derivatives
biological_process GO:0009063 - cellular amino acid catabolic process
GO:0009254 - peptidoglycan turnover
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [2] Vick JE., et al., 2007
External database links:  
ECOCYC:
G6661-MONOMER
ECOLIWIKI:
b1325
INTERPRO:
IPR013342
INTERPRO:
IPR034603
INTERPRO:
IPR013341
INTERPRO:
IPR036849
INTERPRO:
IPR018110
INTERPRO:
IPR029017
INTERPRO:
IPR029065
MODBASE:
P51981
PANTHER:
PTHR13794
PDB:
1JPD
PFAM:
PF02746
PFAM:
PF13378
PRIDE:
P51981
PROSITE:
PS00909
PROSITE:
PS00908
PROTEINMODELPORTAL:
P51981
REFSEQ:
NP_415841
SMART:
SM00922
SMR:
P51981
UNIPROT:
P51981


Operon      
Name: ycjG         
Operon arrangement:
Transcription unit        Promoter
ycjG


Transcriptional Regulation      
Display Regulation             
Repressed by: PgrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1748 (cluster) 1388610 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1749 1388656 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1750 1390618 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1751 1390623 reverse nd [RS-EPT-CBR] [3]
  promoter mpaAp2 1390637 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter mpaAp4 1390639 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_1752 1390681 reverse nd [RS-EPT-CBR] [3]



RegulonDB